JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB167836

Recombinant Human REA protein (denatured) (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human REA protein (denatured) (His tag N-Terminus) is a Human Full Length protein, in the 1 to 299 aa range, expressed in Escherichia coli, with >85%, suitable for SDS-PAGE.

View Alternative Names

BAP, REA, PHB2, Prohibitin-2, B-cell receptor-associated protein BAP37, D-prohibitin, Repressor of estrogen receptor activity

1 Images
SDS-PAGE - Recombinant Human REA protein (denatured) (His tag N-Terminus) (AB167836)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human REA protein (denatured) (His tag N-Terminus) (AB167836)

15% SDS-PAGE analysis of ab167836 (3 µg).

Key facts

Purity

>85% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Q99623

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 2.4% Urea, 0.32% Tris HCl

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

PHB2 acts as a mediator of transcriptional repression by nuclear hormone receptors via recruitment of histone deacetylases by similarity. This protein functions as an estrogen receptor (ER)-selective coregulator that potentiates the inhibitory activities of antiestrogens and represses the activity of estrogens. PHB2 competes with NCOA1 for modulation of ER transcriptional activity. It is probably involved in regulating mitochondrial respiration activity and in aging. Recombinant human PHB2 protein, fused to His-tag at N-terminus, was expressed in E.coli.

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSMAQNLKDLAGRLPAGPRGMGTALKLLLGAGAVAYGVRESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK","proteinLength":"Full Length","predictedMolecularWeight":"35.7 kDa","actualMolecularWeight":null,"aminoAcidEnd":299,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q99623","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

REA also known as repressor of estrogen receptor activity is a protein that plays a role in estrogen receptor signaling pathways. REA has a molecular mass of approximately 69 kDa. It expresses widely in various tissues including the heart brain and skeletal muscle. This protein interacts with a number of transcriptional regulators to modulate gene expression. "Antirea" and "Protin rea" sometimes refer to tools used to study its function or its expression in research contexts.
Biological function summary

REA acts as a co-regulator in estrogen receptor complexes influencing the transcriptional activity of these receptors. It binds with estrogen receptors to either suppress or enhance their activity based on the cellular context and signaling molecules involved. Through this modulation REA contributes to the regulation of genes involved in cell growth differentiation and survival. Its ability to interact with other proteins such as coactivators and corepressors positions REA as an important player in modulating cellular responses to estrogen.

Pathways

REA is embedded in the estrogen signaling pathway which is critical for the regulation of reproductive tissues and certain non-reproductive tissues. It interacts with proteins like steroid receptor coactivator-3 (SRC-3) and nuclear receptor corepressor (NCoR) to influence pathway dynamics. Additionally REA connects with the MAPK signaling pathway impacting cell proliferation and survival by interacting with proteins such as MAPK and ERK2. These interactions place REA as a central node in hormone signaling networks within the cell.

The alterations in REA function have links to breast cancer and endometriosis. In breast cancer abnormal REA levels can disrupt estrogen signaling affecting tumor growth and progression. Coregulators like SRC-3 further modulate the disease outcome through their interaction with REA. In the case of endometriosis REA influences estrogen-driven processes contributing to the pathology of the disorder. Understanding REA's interactions offers insights into therapeutic targets and potential treatment strategies for these conditions.

Specifications

Form

Liquid

General info

Function

Protein with pleiotropic attributes mediated in a cell-compartment- and tissue-specific manner, which include the plasma membrane-associated cell signaling functions, mitochondrial chaperone, and transcriptional co-regulator of transcription factors and sex steroid hormones in the nucleus.. In the mitochondria, together with PHB, forms large ring complexes (prohibitin complexes) in the inner mitochondrial membrane (IMM) and functions as a chaperone protein that stabilizes mitochondrial respiratory enzymes and maintains mitochondrial integrity in the IMM, which is required for mitochondrial morphogenesis, neuronal survival, and normal lifespan (Probable). The prohibitin complex, with DNAJC19, regulates cardiolipin remodeling and the protein turnover of OMA1 in a cardiolipin-binding manner (By similarity). Also regulates cytochrome-c oxidase assembly (COX) and mitochondrial respiration (PubMed : 11302691, PubMed : 20959514). Binding to sphingoid 1-phosphate (SPP) modulates its regulator activity (PubMed : 11302691, PubMed : 20959514). Has a key role of mitophagy receptor involved in targeting mitochondria for autophagic degradation (PubMed : 28017329). Involved in mitochondrial-mediated antiviral innate immunity, activates RIG-I-mediated signal transduction and production of IFNB1 and pro-inflammatory cytokine IL6 (PubMed : 31522117).. In the nucleus, serves as transcriptional co-regulator (Probable). Acts as a mediator of transcriptional repression by nuclear hormone receptors via recruitment of histone deacetylases. Functions as an estrogen receptor (ER)-selective coregulator that potentiates the inhibitory activities of antiestrogens and represses the activity of estrogens. Competes with NCOA1 for modulation of ER transcriptional activity (By similarity).. In the plasma membrane, is involved in IGFBP6-induced cell migration (PubMed : 24003225). Cooperates with CD86 to mediate CD86-signaling in B lymphocytes that regulates the level of IgG1 produced through the activation of distal signaling intermediates. Upon CD40 engagement, required to activate NF-kappa-B signaling pathway via phospholipase C and protein kinase C activation (By similarity).. (Microbial infection) Involved in human enterovirus 71/EV-71 infection by enhancing the autophagy mechanism during the infection.

Sequence similarities

Belongs to the prohibitin family.

Post-translational modifications

Phosphorylated. Tyrosine phosphorylation is indirectly stimulated by IGFBP6.

Subcellular localisation

Mitochondrion inner membrane

Product protocols

Target data

Protein with pleiotropic attributes mediated in a cell-compartment- and tissue-specific manner, which include the plasma membrane-associated cell signaling functions, mitochondrial chaperone, and transcriptional co-regulator of transcription factors and sex steroid hormones in the nucleus.. In the mitochondria, together with PHB, forms large ring complexes (prohibitin complexes) in the inner mitochondrial membrane (IMM) and functions as a chaperone protein that stabilizes mitochondrial respiratory enzymes and maintains mitochondrial integrity in the IMM, which is required for mitochondrial morphogenesis, neuronal survival, and normal lifespan (Probable). The prohibitin complex, with DNAJC19, regulates cardiolipin remodeling and the protein turnover of OMA1 in a cardiolipin-binding manner (By similarity). Also regulates cytochrome-c oxidase assembly (COX) and mitochondrial respiration (PubMed : 11302691, PubMed : 20959514). Binding to sphingoid 1-phosphate (SPP) modulates its regulator activity (PubMed : 11302691, PubMed : 20959514). Has a key role of mitophagy receptor involved in targeting mitochondria for autophagic degradation (PubMed : 28017329). Involved in mitochondrial-mediated antiviral innate immunity, activates RIG-I-mediated signal transduction and production of IFNB1 and pro-inflammatory cytokine IL6 (PubMed : 31522117).. In the nucleus, serves as transcriptional co-regulator (Probable). Acts as a mediator of transcriptional repression by nuclear hormone receptors via recruitment of histone deacetylases. Functions as an estrogen receptor (ER)-selective coregulator that potentiates the inhibitory activities of antiestrogens and represses the activity of estrogens. Competes with NCOA1 for modulation of ER transcriptional activity (By similarity).. In the plasma membrane, is involved in IGFBP6-induced cell migration (PubMed : 24003225). Cooperates with CD86 to mediate CD86-signaling in B lymphocytes that regulates the level of IgG1 produced through the activation of distal signaling intermediates. Upon CD40 engagement, required to activate NF-kappa-B signaling pathway via phospholipase C and protein kinase C activation (By similarity).. (Microbial infection) Involved in human enterovirus 71/EV-71 infection by enhancing the autophagy mechanism during the infection.
See full target information PHB2

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com