JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB192295

Recombinant Human REG3G protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human REG3G protein is a Human Full Length protein, in the 27 to 175 aa range, expressed in HEK 293 cells, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE, HPLC.

View Alternative Names

PAP1B, UNQ429/PRO162, REG3G, Regenerating islet-derived protein 3-gamma, REG-3-gamma, Pancreatitis-associated protein 1B, Pancreatitis-associated protein IB, Regenerating islet-derived protein III-gamma, PAP-1B, PAP IB, REG III, Reg III-gamma

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

HEK 293 cells

Tags

His tag C-Terminus

Applications

SDS-PAGE, HPLC

applications

Biologically active

No

Accession

Q6UW15

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: 99% Phosphate Buffer, 0.87% Sodium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"EETQKELPSPRISCPKGSKAYGSPCYALFLSPKSWMDADLACQKRPSGKLVSVLSGAEGSFVSSLVRSISNSYSYIWIGLHDPTQGSEPDGDGWEWSSTDVMNYFAWEKNPSTILNPGHCGSLSRSTGFLKWKDYNCDAKLPYVCKFKDVDHHHHHH","proteinLength":"Full Length","predictedMolecularWeight":"17.54 kDa","actualMolecularWeight":null,"aminoAcidEnd":175,"aminoAcidStart":27,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q6UW15","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-80°C
Storage information
Avoid freeze / thaw cycle|Reconstitute for long term storage
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

REG3G also known as Regenerating islet-derived protein 3-gamma is a member of the C-type lectin family. It has a molecular weight of about 19 kDa. This protein is expressed mainly in the epithelial cells of the intestine particularly in the ileum and colon. REG3G also shows expression in the pancreas and liver. The primary function of REG3G involves its bactericidal activity where it binds to peptidoglycan in the bacterial cell wall and disrupts it to kill bacteria.
Biological function summary

REG3G plays a role in innate immune responses by maintaining homeostasis in the intestinal mucosa. It is not reported as part of a larger protein complex. REG3G helps modulate the gut microbiota and provides protection against pathogenic bacteria. The ability to control bacterial populations in the gut and prevent invasion highlights the protein’s role in the body's defense mechanisms.

Pathways

REG3G participates in the antimicrobial peptide pathway contributing to mucosal immunity. This pathway plays an important role in the gastrointestinal tract where it prevents infection by pathogens. REG3G is related to other antimicrobial peptides such as REG3A and defensins which collectively enhance the mucosal barrier and protect against microbial invasion.

REG3G is linked to inflammatory bowel disease (IBD) and its expression levels can indicate the inflammatory state of the intestine. Studies have shown that changes in REG3G levels relate to Crohn's disease. Moreover REG3G has connections to diabetes particularly in terms of pancreatic beta-cell stress. It shares functional roles with proteins like REG3B suggesting a broader involvement in tissue regeneration processes.

Specifications

Form

Lyophilized

Additional notes

Determined by SEC-HPLC and reducing SDS-PAGE.

General info

Function

Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Restricts bacterial colonization of the intestinal epithelial surface and consequently limits activation of adaptive immune responses by the microbiota.. Acts as a hormone in response to different stimuli like anti-inflammatory signals, such as IL17A, or gut microbiome. Is secreted by different cell types to activate its receptor EXTL3 and induce cell specific signaling pathways. Induced by IL17A in keratinocytes, regulates keratinocyte proliferation and differentiation after skin injury. In parallel, inhibits skin inflammation through the inhibition of inflammatory cytokines such as IL6 and TNF. Induced by IL22 in lung epithelial cells, inhibits cytokine production and regulates allergic airway inflammation. Induced in small intestine by inulin-enriched diet and Lactobacillus gasseri enriched microbiome, plays a role in the improvement of gut barrier function, the regulation of energy balance and glucose levels. Modulates microbiota composition in duodenal contents. Produced by nociceptor in response to endotoxins, prevents endotoxic death by targeting kynurenine pathway in microglia.. Regenerating islet-derived protein 3-gamma 16.5 kDa form. Has bacteriostatic activity.. Regenerating islet-derived protein 3-gamma 15 kDa form. Has bactericidal activity against L.monocytogenes and methicillin-resistant S.aureus.

Post-translational modifications

Proteolytic processing by trypsin removes an inhibitory N-terminal propeptide and is essential for peptidoglycan binding and antibacterial activity.

Product protocols

Target data

Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Restricts bacterial colonization of the intestinal epithelial surface and consequently limits activation of adaptive immune responses by the microbiota.. Acts as a hormone in response to different stimuli like anti-inflammatory signals, such as IL17A, or gut microbiome. Is secreted by different cell types to activate its receptor EXTL3 and induce cell specific signaling pathways. Induced by IL17A in keratinocytes, regulates keratinocyte proliferation and differentiation after skin injury. In parallel, inhibits skin inflammation through the inhibition of inflammatory cytokines such as IL6 and TNF. Induced by IL22 in lung epithelial cells, inhibits cytokine production and regulates allergic airway inflammation. Induced in small intestine by inulin-enriched diet and Lactobacillus gasseri enriched microbiome, plays a role in the improvement of gut barrier function, the regulation of energy balance and glucose levels. Modulates microbiota composition in duodenal contents. Produced by nociceptor in response to endotoxins, prevents endotoxic death by targeting kynurenine pathway in microglia.. Regenerating islet-derived protein 3-gamma 16.5 kDa form. Has bacteriostatic activity.. Regenerating islet-derived protein 3-gamma 15 kDa form. Has bactericidal activity against L.monocytogenes and methicillin-resistant S.aureus.
See full target information REG3G

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com