JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB225966

Recombinant Human Reptin/TIP49B/RUVB2 protein (His tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Reptin/TIP49B/RUVB2 protein (His tag) is a Human Full Length protein, in the 2 to 463 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE.

View Alternative Names

INO80J, TIP48, TIP49B, CGI-46, RUVBL2, RuvB-like 2, 48 kDa TATA box-binding protein-interacting protein, 51 kDa erythrocyte cytosolic protein, INO80 complex subunit J, Repressing pontin 52, TIP49b, TIP60-associated protein 54-beta, 48 kDa TBP-interacting protein, ECP-51, Reptin 52, TAP54-beta

1 Images
SDS-PAGE - Recombinant Human Reptin/TIP49B/RUVB2 protein (His tag) (AB225966)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Reptin/TIP49B/RUVB2 protein (His tag) (AB225966)

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab225966 with 5% enrichment gel and 15% separation gel.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Q9Y230

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.2 - 7.4 Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"ATVTATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDTS","proteinLength":"Full Length","predictedMolecularWeight":"67 kDa","actualMolecularWeight":null,"aminoAcidEnd":463,"aminoAcidStart":2,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q9Y230","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Reptin also known as TIP49B or RUVB2 is an ATPase with a mass of approximately 52 kDa. It is expressed ubiquitously across various tissues playing significant roles in cellular processes. Mechanically Reptin functions as part of a complex that facilitates chromatin remodeling and transcription regulation. It often works in conjunction with its paralog Pontin/TIP49A/RUVB1 forming a dodecameric ring structure essential for its activity.
Biological function summary

Reptin plays essential roles in modulating gene expression and contributing to the assembly of ribonucleoprotein complexes. It forms part of the chromatin remodeling complexes such as INO80 and TIP60 participating in DNA repair processes and transcriptional regulation. Its function in these complexes makes it indispensable for maintaining genomic integrity and controlling cell cycle progression.

Pathways

Various critical cellular pathways involve Reptin's biological function. It is an important player in the Wnt/beta-catenin signaling pathway where it regulates the transcription of target genes. Additionally Reptin associates with the Myc pathway contributing to oncogenic transformation. In these pathways Reptin interacts with proteins like beta-catenin and c-Myc integrating signals necessary for cell proliferation and differentiation.

Aberrant Reptin activity links to cancer and neurological disorders. Overexpression of Reptin has strong connections to tumor progression and metastasis in cancers including colorectal and lung cancer. In these diseases Reptin partners with proteins such as c-Myc augmenting its transcriptional activity to promote cell growth. Additionally Reptin's dysregulation may influence neurodegenerative conditions by disrupting protein complexes involved in maintaining neural functions.

Specifications

Form

Liquid

General info

Function

Possesses single-stranded DNA-stimulated ATPase and ATP-dependent DNA helicase (5' to 3') activity; hexamerization is thought to be critical for ATP hydrolysis and adjacent subunits in the ring-like structure contribute to the ATPase activity (PubMed : 10428817, PubMed : 17157868, PubMed : 33205750). Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A (PubMed : 14966270). This modification may both alter nucleosome -DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription (PubMed : 14966270). This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair (PubMed : 14966270). The NuA4 complex ATPase and helicase activities seem to be, at least in part, contributed by the association of RUVBL1 and RUVBL2 with EP400 (PubMed : 14966270). NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage (PubMed : 14966270). Component of a SWR1-like complex that specifically mediates the removal of histone H2A.Z/H2AZ1 from the nucleosome (PubMed : 24463511). Proposed core component of the chromatin remodeling INO80 complex which exhibits DNA- and nucleosome-activated ATPase activity and catalyzes ATP-dependent nucleosome sliding (PubMed : 16230350, PubMed : 21303910). Plays an essential role in oncogenic transformation by MYC and also modulates transcriptional activation by the LEF1/TCF1-CTNNB1 complex (PubMed : 10882073, PubMed : 16014379). May also inhibit the transcriptional activity of ATF2 (PubMed : 11713276). Involved in the endoplasmic reticulum (ER)-associated degradation (ERAD) pathway where it negatively regulates expression of ER stress response genes (PubMed : 25652260). May play a role in regulating the composition of the U5 snRNP complex (PubMed : 28561026).

Sequence similarities

Belongs to the RuvB family.

Subcellular localisation

Nucleus matrix

Product protocols

Target data

Possesses single-stranded DNA-stimulated ATPase and ATP-dependent DNA helicase (5' to 3') activity; hexamerization is thought to be critical for ATP hydrolysis and adjacent subunits in the ring-like structure contribute to the ATPase activity (PubMed : 10428817, PubMed : 17157868, PubMed : 33205750). Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A (PubMed : 14966270). This modification may both alter nucleosome -DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription (PubMed : 14966270). This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair (PubMed : 14966270). The NuA4 complex ATPase and helicase activities seem to be, at least in part, contributed by the association of RUVBL1 and RUVBL2 with EP400 (PubMed : 14966270). NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage (PubMed : 14966270). Component of a SWR1-like complex that specifically mediates the removal of histone H2A.Z/H2AZ1 from the nucleosome (PubMed : 24463511). Proposed core component of the chromatin remodeling INO80 complex which exhibits DNA- and nucleosome-activated ATPase activity and catalyzes ATP-dependent nucleosome sliding (PubMed : 16230350, PubMed : 21303910). Plays an essential role in oncogenic transformation by MYC and also modulates transcriptional activation by the LEF1/TCF1-CTNNB1 complex (PubMed : 10882073, PubMed : 16014379). May also inhibit the transcriptional activity of ATF2 (PubMed : 11713276). Involved in the endoplasmic reticulum (ER)-associated degradation (ERAD) pathway where it negatively regulates expression of ER stress response genes (PubMed : 25652260). May play a role in regulating the composition of the U5 snRNP complex (PubMed : 28561026).
See full target information RUVBL2

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com