JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB186463

Recombinant human Ret (mutated V804M) protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human Ret (mutated V804M) protein (GST tag N-Terminus) is a Human Fragment protein, in the 658 to 1072 aa range, expressed in Baculovirus infected Sf9 cells, with >90%, suitable for SDS-PAGE, FuncS.
2 Images
Functional Studies - Recombinant human Ret (mutated V804M) protein (GST tag N-Terminus) (AB186463)
  • FuncS

Supplier Data

Functional Studies - Recombinant human Ret (mutated V804M) protein (GST tag N-Terminus) (AB186463)

Kinase Assay demonstrating specific activity of ab186463.

SDS-PAGE - Recombinant human Ret (mutated V804M) protein (GST tag N-Terminus) (AB186463)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human Ret (mutated V804M) protein (GST tag N-Terminus) (AB186463)

SDS-PAGE analysis of ab186463.

Key facts

Purity

>90% Densitometry

Affinity purified.

Expression system

Baculovirus infected Sf9 cells

Tags

GST tag N-Terminus

Applications

FuncS, SDS-PAGE

applications

Biologically active

Yes

Biological activity

The specific activity of ab186463 was determined to be 180 nmol/min/mg as per activity assay protocol.

Accession

P07949-2

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.5 Constituents: 25% Glycerol (glycerin, glycerine), 0.88% Sodium chloride, 0.79% Tris HCl, 0.31% Glutathione, 0.004% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 0.003% EDTA, 0.002% PMSF

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"linker":null,"sequence":"HCYHKFAHKPPISSAEMTFRRPAQAFPVSYSSSGARRPSLDSMENQVSVDAFKILEDPKWEFPRKNLVLGKTLGEGEFGKVVKATAFHLKGRAGYTTVAVKMLKENASPSELRDLLSEFNVLKQVNHPHVIKLYGACSQDGPLLLIMEYAKYGSLRGFLRESRKVGPGYLGSGGSRNSSSLDHPDERALTMGDLISFAWQISQGMQYLAEMKLVHRDLAARNILVAEGRKMKISDFGLSRDVYEEDSYVKRSQGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIPPERLFNLLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMMVKRRDYLDLAASTPSDSLIYDDGLSEEETPLVDCNNAPLPRALPSTWIENKLYGRISHAFTRF","proteinLength":"Fragment","predictedMolecularWeight":"74 kDa","actualMolecularWeight":null,"aminoAcidEnd":1072,"aminoAcidStart":658,"nature":"Recombinant","expressionSystem":"Baculovirus infected Sf9 cells","accessionNumber":"P07949","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Form
Liquid
Purification technique
Affinity purification
Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Ret also known as "rearranged during transfection" is a receptor tyrosine kinase with a mass of approximately 170-175 kDa. Scientists often study Ret because of its key role in cellular signaling pathways. It is primarily expressed in neural crest-derived cells and tissues including the kidneys and the enteric nervous system. Ret is also found in various other cell types throughout the body such as endocrine and hematopoietic tissues.
Biological function summary

The Ret protein facilitates several critical processes within the body. It functions as part of a complex with co-receptors called GFRα (GDNF family receptor alpha) which are required for binding ligands such as GDNF (glial cell line-derived neurotrophic factor). This binding activates downstream signaling pathways that influence cell growth differentiation and survival particularly within the nervous system. The proper functioning of Ret is essential for the development and maintenance of these cellular environments.

Pathways

Ret is an important component of the MAPK/ERK and PI3K/AKT signaling pathways. These pathways mediate various cellular responses including cell proliferation survival and apoptosis. The interactions of Ret with other proteins like SHC and GRB2 within these pathways create ripple effects that impact larger cellular networks. Through these pathways Ret connects with multiple proteins to modulate essential biological processes.

Ret's dysregulation is closely associated with multiple endocrine neoplasia type 2 (MEN2) and Hirschsprung's disease. These conditions arise due to mutations affecting Ret's signaling capabilities. In MEN2 Ret mutations lead to uncontrolled cell growth often resulting in medullary thyroid carcinoma. Hirschsprung's disease on the other hand involves a failure in neural crest cell migration leading to congenital gut motility issues. Researchers explore Ret's interactions with other proteins such as endothelin receptor B (EDNRB) to further understand these diseases.

General info

Function

Receptor tyrosine-protein kinase involved in numerous cellular mechanisms including cell proliferation, neuronal navigation, cell migration, and cell differentiation in response to glia cell line-derived growth family factors (GDNF, NRTN, ARTN, PSPN and GDF15) (PubMed : 20064382, PubMed : 20616503, PubMed : 20702524, PubMed : 21357690, PubMed : 21454698, PubMed : 24560924, PubMed : 28846097, PubMed : 28846099, PubMed : 28953886, PubMed : 31118272). In contrast to most receptor tyrosine kinases, RET requires not only its cognate ligands but also coreceptors, for activation (PubMed : 21994944, PubMed : 23333276, PubMed : 28846097, PubMed : 28846099, PubMed : 28953886). GDNF ligands (GDNF, NRTN, ARTN, PSPN and GDF15) first bind their corresponding GDNFR coreceptors (GFRA1, GFRA2, GFRA3, GFRA4 and GFRAL, respectively), triggering RET autophosphorylation and activation, leading to activation of downstream signaling pathways, including the MAPK- and AKT-signaling pathways (PubMed : 21994944, PubMed : 23333276, PubMed : 24560924, PubMed : 25242331, PubMed : 28846097, PubMed : 28846099, PubMed : 28953886). Acts as a dependence receptor via the GDNF-GFRA1 signaling : in the presence of the ligand GDNF in somatotrophs within pituitary, promotes survival and down regulates growth hormone (GH) production, but triggers apoptosis in absence of GDNF (PubMed : 20616503, PubMed : 21994944). Required for the molecular mechanisms orchestration during intestine organogenesis via the ARTN-GFRA3 signaling : involved in the development of enteric nervous system and renal organogenesis during embryonic life, and promotes the formation of Peyer's patch-like structures, a major component of the gut-associated lymphoid tissue (By similarity). Mediates, through interaction with GDF15-receptor GFRAL, GDF15-induced cell-signaling in the brainstem which triggers an aversive response, characterized by nausea, vomiting, and/or loss of appetite in response to various stresses (PubMed : 28846097, PubMed : 28846099, PubMed : 28953886). Modulates cell adhesion via its cleavage by caspase in sympathetic neurons and mediates cell migration in an integrin (e.g. ITGB1 and ITGB3)-dependent manner (PubMed : 20702524, PubMed : 21357690). Also active in the absence of ligand, triggering apoptosis through a mechanism that requires receptor intracellular caspase cleavage (PubMed : 21357690). Triggers the differentiation of rapidly adapting (RA) mechanoreceptors (PubMed : 20064382). Involved in the development of the neural crest (By similarity). Regulates nociceptor survival and size (By similarity). Phosphorylates PTK2/FAK1 (PubMed : 21454698).. Isoform 1. Isoform 1 in complex with GFRAL induces higher activation of MAPK-signaling pathway than isoform 2 in complex with GFRAL.

Sequence similarities

Belongs to the protein kinase superfamily. Tyr protein kinase family.

Post-translational modifications

Autophosphorylated on C-terminal tyrosine residues upon ligand stimulation.. Proteolytically cleaved by caspase-3. The soluble RET kinase fragment is able to induce cell death. The extracellular cell-membrane anchored RET cadherin fragment accelerates cell adhesion in sympathetic neurons.

Subcellular localisation

Endosome membrane

Product protocols

Target data

Receptor tyrosine-protein kinase involved in numerous cellular mechanisms including cell proliferation, neuronal navigation, cell migration, and cell differentiation in response to glia cell line-derived growth family factors (GDNF, NRTN, ARTN, PSPN and GDF15) (PubMed : 20064382, PubMed : 20616503, PubMed : 20702524, PubMed : 21357690, PubMed : 21454698, PubMed : 24560924, PubMed : 28846097, PubMed : 28846099, PubMed : 28953886, PubMed : 31118272). In contrast to most receptor tyrosine kinases, RET requires not only its cognate ligands but also coreceptors, for activation (PubMed : 21994944, PubMed : 23333276, PubMed : 28846097, PubMed : 28846099, PubMed : 28953886). GDNF ligands (GDNF, NRTN, ARTN, PSPN and GDF15) first bind their corresponding GDNFR coreceptors (GFRA1, GFRA2, GFRA3, GFRA4 and GFRAL, respectively), triggering RET autophosphorylation and activation, leading to activation of downstream signaling pathways, including the MAPK- and AKT-signaling pathways (PubMed : 21994944, PubMed : 23333276, PubMed : 24560924, PubMed : 25242331, PubMed : 28846097, PubMed : 28846099, PubMed : 28953886). Acts as a dependence receptor via the GDNF-GFRA1 signaling : in the presence of the ligand GDNF in somatotrophs within pituitary, promotes survival and down regulates growth hormone (GH) production, but triggers apoptosis in absence of GDNF (PubMed : 20616503, PubMed : 21994944). Required for the molecular mechanisms orchestration during intestine organogenesis via the ARTN-GFRA3 signaling : involved in the development of enteric nervous system and renal organogenesis during embryonic life, and promotes the formation of Peyer's patch-like structures, a major component of the gut-associated lymphoid tissue (By similarity). Mediates, through interaction with GDF15-receptor GFRAL, GDF15-induced cell-signaling in the brainstem which triggers an aversive response, characterized by nausea, vomiting, and/or loss of appetite in response to various stresses (PubMed : 28846097, PubMed : 28846099, PubMed : 28953886). Modulates cell adhesion via its cleavage by caspase in sympathetic neurons and mediates cell migration in an integrin (e.g. ITGB1 and ITGB3)-dependent manner (PubMed : 20702524, PubMed : 21357690). Also active in the absence of ligand, triggering apoptosis through a mechanism that requires receptor intracellular caspase cleavage (PubMed : 21357690). Triggers the differentiation of rapidly adapting (RA) mechanoreceptors (PubMed : 20064382). Involved in the development of the neural crest (By similarity). Regulates nociceptor survival and size (By similarity). Phosphorylates PTK2/FAK1 (PubMed : 21454698).. Isoform 1. Isoform 1 in complex with GFRAL induces higher activation of MAPK-signaling pathway than isoform 2 in complex with GFRAL.
See full target information RET V804M

Alternative Names

CDHF12, CDHR16, PTC, RET, RET51, Proto-oncogene tyrosine-protein kinase receptor Ret, Cadherin family member 12, Proto-oncogene c-Ret

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com