JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB159360

Recombinant Human RING2 / RING1B / RNF2 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human RING2 / RING1B / RNF2 protein is a Human Full Length protein, in the 1 to 336 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

BAP1, DING, HIPI3, RING1B, RNF2, E3 ubiquitin-protein ligase RING2, Huntingtin-interacting protein 2-interacting protein 3, Protein DinG, RING finger protein 1B, RING finger protein 2, RING finger protein BAP-1, RING-type E3 ubiquitin transferase RING2, HIP2-interacting protein 3, RING1b

1 Images
SDS-PAGE - Recombinant Human RING2 / RING1B / RNF2 protein (AB159360)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human RING2 / RING1B / RNF2 protein (AB159360)

ab159360 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, ELISA

applications

Biologically active

No

Accession

Q99496

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MSQAVQTNGTQPLSKTWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQERVLARINKHNNQQALSHSIEEGLKIQAMNRLQRGKKQQIENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAMAIDPVMDGASEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQYTIYIATASGQFTVLNGSFSLELVSEKYWKVNKPMELYYAPTKEHK","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":336,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q99496","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

RING2 also known as RING1B or RNF2 is a protein that functions as a member of the Polycomb Repressive Complex 1 (PRC1). This protein contains a RING-finger domain facilitating ubiquitin ligase activity. It has a molecular mass of approximately 38 kDa. RING2/RNF2/RING1B is expressed in various tissues including the brain heart and lungs indicating its fundamental role across different biological systems.
Biological function summary

RING2/RNF2/RING1B regulates gene expression by modifying chromatin structure especially through monoubiquitination of histone H2A at lysine 119. This action occurs within the Polycomb Repressive Complex 1 a multiprotein structure important for maintaining the transcriptional repression of target genes. It influences cell cycle progression and development by silencing genes involved in proliferation and differentiation.

Pathways

RING2/RNF2/RING1B's role connects to the Polycomb group (PcG) pathway and the Wnt signaling pathway. Within these pathways it interacts with proteins like BMI1 and EZH2 which are other components of polycomb complexes. These interactions help modulate chromatin dynamics and control the expression of several genes involved in cell identity and development.

Dysfunction or aberrant expression of RING2/RNF2/RING1B has links to cancer and neurological disorders. Its relationship with proteins like CBX8 ties it to pathways of oncogenesis where it can influence tumorigenesis through misregulation of gene silencing. Furthermore changes in RING2/RNF2/RING1B expression or function may contribute to developmental disorders associated with improper neuronal development.

Specifications

Form

Liquid

General info

Function

E3 ubiquitin-protein ligase that mediates monoubiquitination of 'Lys-119' of histone H2A (H2AK119Ub), thereby playing a central role in histone code and gene regulation (PubMed : 15386022, PubMed : 16359901, PubMed : 21772249, PubMed : 25355358, PubMed : 25519132, PubMed : 26151332, PubMed : 33864376). H2AK119Ub gives a specific tag for epigenetic transcriptional repression and participates in X chromosome inactivation of female mammals. May be involved in the initiation of both imprinted and random X inactivation (By similarity). Essential component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development (PubMed : 16359901, PubMed : 26151332). PcG PRC1 complex acts via chromatin remodeling and modification of histones, rendering chromatin heritably changed in its expressibility (PubMed : 26151332). E3 ubiquitin-protein ligase activity is enhanced by BMI1/PCGF4 (PubMed : 21772249). Acts as the main E3 ubiquitin ligase on histone H2A of the PRC1 complex, while RING1 may rather act as a modulator of RNF2/RING2 activity (Probable). Association with the chromosomal DNA is cell-cycle dependent. In resting B- and T-lymphocytes, interaction with AURKB leads to block its activity, thereby maintaining transcription in resting lymphocytes (By similarity). Also acts as a negative regulator of autophagy by mediating ubiquitination of AMBRA1, leading to its subsequent degradation (By similarity).

Post-translational modifications

Monoubiquitinated, by auto-ubiquitination (By similarity). Polyubiquitinated in the presence of UBE2D3 (in vitro) (PubMed:26151332).

Subcellular localisation

Nucleus

Product protocols

Target data

E3 ubiquitin-protein ligase that mediates monoubiquitination of 'Lys-119' of histone H2A (H2AK119Ub), thereby playing a central role in histone code and gene regulation (PubMed : 15386022, PubMed : 16359901, PubMed : 21772249, PubMed : 25355358, PubMed : 25519132, PubMed : 26151332, PubMed : 33864376). H2AK119Ub gives a specific tag for epigenetic transcriptional repression and participates in X chromosome inactivation of female mammals. May be involved in the initiation of both imprinted and random X inactivation (By similarity). Essential component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development (PubMed : 16359901, PubMed : 26151332). PcG PRC1 complex acts via chromatin remodeling and modification of histones, rendering chromatin heritably changed in its expressibility (PubMed : 26151332). E3 ubiquitin-protein ligase activity is enhanced by BMI1/PCGF4 (PubMed : 21772249). Acts as the main E3 ubiquitin ligase on histone H2A of the PRC1 complex, while RING1 may rather act as a modulator of RNF2/RING2 activity (Probable). Association with the chromosomal DNA is cell-cycle dependent. In resting B- and T-lymphocytes, interaction with AURKB leads to block its activity, thereby maintaining transcription in resting lymphocytes (By similarity). Also acts as a negative regulator of autophagy by mediating ubiquitination of AMBRA1, leading to its subsequent degradation (By similarity).
See full target information RNF2

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com