JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB162124

Recombinant Human RNF115 protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human RNF115 protein (GST tag N-Terminus) is a Human Full Length protein, in the 1 to 304 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

ZNF364, RNF115, E3 ubiquitin-protein ligase RNF115, RING finger protein 115, RING-type E3 ubiquitin transferase RNF115, Rab7-interacting RING finger protein, Zinc finger protein 364, Rabring 7

1 Images
SDS-PAGE - Recombinant Human RNF115 protein (GST tag N-Terminus) (AB162124)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human RNF115 protein (GST tag N-Terminus) (AB162124)

ab162124 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, WB

applications

Biologically active

No

Accession

Q9Y4L5

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This product was previously labelled as ZNF364.

Sequence info

[{"sequence":"MAEASAAGADSGAAVAAHRFFCHFCKGEVSPKLPEYICPRCESGFIEEVTDDSSFLGGGGSRIDNTTTTHFAELWGHLDHTMFFQDFRPFLSSSPLDQDNRANERGHQTHTDFWGARPPRLPLGRRYRSRGSSRPDRSPAIEGILQHIFAGFFANSAIPGSPHPFSWSGMLHSNPGDYAWGQTGLDAIVTQLLGQLENTGPPPADKEKITSLPTVTVTQEQVDMGLECPVCKEDYTVEEEVRQLPCNHFFHSSCIVPWLELHDTCPVCRKSLNGEDSTRQSQSTEASASNRFSNDSQLHDRWTF","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":304,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q9Y4L5","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

RNF115 also known as RING Finger Protein 115 or BRE1B is an E3 ubiquitin-protein ligase. This protein weighs approximately 34 kDa and belongs to the RBR (RING1-IBR-RING2) E3 ubiquitin ligase family. RNF115 functions mechanically by attaching ubiquitin molecules to specific protein substrates marking them for proteasomal degradation. RNF115 is found in various tissues showing higher expression in the brain and reproductive organs. It plays a mechanical role in proteostasis by facilitating the transfer of ubiquitin from E2 ubiquitin-conjugating enzymes to target proteins.
Biological function summary

RNF115 affects protein regulation through its involvement in ubiquitin-mediated processes. It interacts with different substrates and has been identified as part of the BRCA1-A complex which is important in DNA repair mechanisms. It helps regulate cellular levels and stability of proteins impacting cell cycle progression and response to DNA damage. Its activity ensures proper cellular development and homeostasis by maintaining protein turnover.

Pathways

RNF115 engages in the ubiquitin-proteasome system and is implicated in the DNA damage response pathways. It acts within the ubiquitination pathways collaborating with other proteins like BRCA1 and UBE2D1 to influence protein degradation and DNA repair processes. RNF115's role in the regulation of the DNA damage response highlights its connection to cellular stress resilience linking it to cellular pathways that maintain genetic stability.

Alterations in RNF115 expression or function can link to cancer development and neurodegenerative diseases. Misregulation can impact pathways involving BRCA1 associated with breast cancer contributing to abnormal cell proliferation and genomic instability. Additionally disruptions in its protein degradation function may relate to neurodegenerative diseases where abnormal protein accumulation occurs such as Alzheimer's disease. The connection of RNF115 with proteins like BRCA1 and UBE2D1 in these conditions highlights its importance in maintaining cellular health and preventing disease progression.

Specifications

Form

Liquid

General info

Function

E3 ubiquitin-protein ligase that catalyzes the 'Lys-48'- and/or 'Lys-63'-linked polyubiquitination of various substrates and thereby plays a role in a number of signaling pathways including autophagy, innate immunity, cell proliferation and cell death (PubMed : 20019814, PubMed : 30689267). Plays a role in the endosomal trafficking and degradation of membrane receptors including EGFR, FLT3, MET and CXCR4 through their polyubiquitination. Participates together with BST2 in antiviral immunity by facilitating the internalization of HIV-1 virions into intracellular vesicles leading to their lysosomal degradation (PubMed : 20019814). Also possesses an antiviral activity independently of BST2 by promoting retroviral GAG proteins ubiquitination, redistribution to endo-lysosomal compartments and, ultimately, lysosomal degradation (PubMed : 24852021). Catalyzes distinct types of ubiquitination on MAVS and STING1 at different phases of viral infection to promote innate antiviral response (PubMed : 33139700). Mediates the 'Lys-48'-linked ubiquitination of MAVS leading to its proteasomal degradation and ubiquitinates STING1 via 'Lys-63'-linked polyubiquitination, critical for its oligomerization and the subsequent recruitment of TBK1 (PubMed : 33139700). Plays a positive role in the autophagosome-lysosome fusion by interacting with STX17 and enhancing its stability without affecting 'Lys-48'- or 'Lys-63'-linked polyubiquitination levels, which in turn promotes autophagosome maturation (PubMed : 32980859). Negatively regulates TLR-induced expression of proinflammatory cytokines by catalyzing 'Lys-11'-linked ubiquitination of RAB1A and RAB13 to inhibit post-ER trafficking of TLRs to the Golgi by RAB1A and subsequently from the Golgi apparatus to the cell surface by RAB13 (PubMed : 35343654).

Post-translational modifications

Phosphorylated by AKT1, allowing association with the 14-3-3 chaperones that facilitates associating with TLRs.. RING-type zinc finger-dependent and E2-dependent autoubiquitination.. Deubiquitinated by USP9X; antogonizing its autoubiquitination and subsequent proteasomal degradation.

Subcellular localisation

Nucleus

Product protocols

Target data

E3 ubiquitin-protein ligase that catalyzes the 'Lys-48'- and/or 'Lys-63'-linked polyubiquitination of various substrates and thereby plays a role in a number of signaling pathways including autophagy, innate immunity, cell proliferation and cell death (PubMed : 20019814, PubMed : 30689267). Plays a role in the endosomal trafficking and degradation of membrane receptors including EGFR, FLT3, MET and CXCR4 through their polyubiquitination. Participates together with BST2 in antiviral immunity by facilitating the internalization of HIV-1 virions into intracellular vesicles leading to their lysosomal degradation (PubMed : 20019814). Also possesses an antiviral activity independently of BST2 by promoting retroviral GAG proteins ubiquitination, redistribution to endo-lysosomal compartments and, ultimately, lysosomal degradation (PubMed : 24852021). Catalyzes distinct types of ubiquitination on MAVS and STING1 at different phases of viral infection to promote innate antiviral response (PubMed : 33139700). Mediates the 'Lys-48'-linked ubiquitination of MAVS leading to its proteasomal degradation and ubiquitinates STING1 via 'Lys-63'-linked polyubiquitination, critical for its oligomerization and the subsequent recruitment of TBK1 (PubMed : 33139700). Plays a positive role in the autophagosome-lysosome fusion by interacting with STX17 and enhancing its stability without affecting 'Lys-48'- or 'Lys-63'-linked polyubiquitination levels, which in turn promotes autophagosome maturation (PubMed : 32980859). Negatively regulates TLR-induced expression of proinflammatory cytokines by catalyzing 'Lys-11'-linked ubiquitination of RAB1A and RAB13 to inhibit post-ER trafficking of TLRs to the Golgi by RAB1A and subsequently from the Golgi apparatus to the cell surface by RAB13 (PubMed : 35343654).
See full target information RNF115

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com