JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB167909

Recombinant Human RPS24 protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human RPS24 protein (His tag N-Terminus) is a Human Full Length protein, in the 1 to 130 aa range, expressed in Escherichia coli, with >85%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

Small ribosomal subunit protein eS24, 40S ribosomal protein S24, RPS24

1 Images
SDS-PAGE - Recombinant Human RPS24 protein (His tag N-Terminus) (AB167909)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human RPS24 protein (His tag N-Terminus) (AB167909)

15% SDS-PAGE analysis of 3 μg ab167909.

Key facts

Purity

>85% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

P62847

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 50% Glycerol (glycerin, glycerine), 1.17% Sodium chloride, 0.32% Tris HCl, 0.03% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSMNDTVTIRTRKFMTNRLLQRKQMVIDVLHPGKATVPKTEIREKLAKMYKTTPDVIFVFGFRTHFGGGKTTGFGMIYDSLDYAKKNEPKHRLARHGLYEKKKTSRKQRKERKNRMKKVRGTAKANVGAGKK","proteinLength":"Full Length","predictedMolecularWeight":"17.5 kDa","actualMolecularWeight":null,"aminoAcidEnd":130,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P62847","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

RPS24 also known as Ribosomal Protein S24 is a component of the 40S ribosomal subunit. It has a molecular mass of approximately 15 kDa. RPS24 is an integral part of the small ribosomal subunit and it is expressed in various tissues highlighting its comprehensive involvement in protein synthesis. As a ribosomal protein RPS24 assists in the translation of mRNA into polypeptide chains by contributing to the correct assembly and function of the ribosome.
Biological function summary

Understanding the function of ribosomal proteins like RPS24 offers insights into protein synthesis. RPS24 achieves its function as part of the 40S ribosomal subunit a critical component of the protein translation machinery in cells. By being part of this complex RPS24 helps in decoding mRNA thereby ensuring the proper translation of the genetic code into proteins. This process is vital for maintaining cellular function and growth supporting the various roles proteins perform within the organism.

Pathways

RPS24 plays a role in the ribosome biogenesis and translation pathways. RPS24 is closely linked with proteins like RPL5 and RPL11 which act within these pathways to regulate ribosome assembly and function. These pathways involve a series of highly coordinated steps controlling ribosome production and activity essential for cell growth and division. By participating in these pathways RPS24 indirectly supports numerous other cellular processes dependent on efficient protein synthesis.

Defects in RPS24 have been associated with Diamond-Blackfan Anemia a rare genetic disorder that affects the bone marrow. RPS24 mutations can impair ribosome function leading to ineffective production of red blood cells. This association with disease highlights the importance of RPS24 in normal hematopoiesis. Additionally RPS24 interacts with proteins such as RPL11 where alterations may contribute to the pathology of this anemia further emphasizing the relevance of RPS24 in both normal and disease states.

Specifications

Form

Liquid

Additional notes

ab167909 is purified using conventional chromatography techniques.

General info

Function

Component of the small ribosomal subunit (PubMed : 23636399). The ribosome is a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell (PubMed : 23636399). Required for processing of pre-rRNA and maturation of 40S ribosomal subunits (PubMed : 18230666). Part of the small subunit (SSU) processome, first precursor of the small eukaryotic ribosomal subunit. During the assembly of the SSU processome in the nucleolus, many ribosome biogenesis factors, an RNA chaperone and ribosomal proteins associate with the nascent pre-rRNA and work in concert to generate RNA folding, modifications, rearrangements and cleavage as well as targeted degradation of pre-ribosomal RNA by the RNA exosome (PubMed : 34516797).

Sequence similarities

Belongs to the eukaryotic ribosomal protein eS24 family.

Product protocols

Target data

Component of the small ribosomal subunit (PubMed : 23636399). The ribosome is a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell (PubMed : 23636399). Required for processing of pre-rRNA and maturation of 40S ribosomal subunits (PubMed : 18230666). Part of the small subunit (SSU) processome, first precursor of the small eukaryotic ribosomal subunit. During the assembly of the SSU processome in the nucleolus, many ribosome biogenesis factors, an RNA chaperone and ribosomal proteins associate with the nascent pre-rRNA and work in concert to generate RNA folding, modifications, rearrangements and cleavage as well as targeted degradation of pre-ribosomal RNA by the RNA exosome (PubMed : 34516797).
See full target information 40S ribosomal protein S24

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com