JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB246420

Recombinant human RSPO1 protein (Active)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human RSPO1 protein (Active) is a Human Fragment protein, in the 31 to 263 aa range, expressed in CHO cells, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS.

View Alternative Names

R-spondin-1, Roof plate-specific spondin-1, hRspo1, RSPO1

1 Images
SDS-PAGE - Recombinant human RSPO1 protein (Active) (AB246420)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant human RSPO1 protein (Active) (AB246420)

SDS-PAGE abalysis of ab246420 (1 μg per lane) under reducing (Lane 1) and non-reducing (Lane 2) conditions.

ab246420 runs at a higher molecular weight than predicted (25.6 kDa) due to glycosylation.

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

CHO cells

Tags

Tag free

Applications

SDS-PAGE, FuncS

applications

Biologically active

Yes

Biological activity

Luciferase induction in HEK-293 STF cells in the presence of Murine Wnt-3a. ED50 ≤ 50 ng/mL (≥ 2.0 x 104 units/mg).

Accession

Q2MKA7

Animal free

No

Carrier free

Yes

Species

Human

Reconstitution

Sterile water at 0.1 mg/mL. Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C, and avoid repeat freeze thaws.

Storage buffer

Constituents: PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"RISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA","proteinLength":"Fragment","predictedMolecularWeight":"25.6 kDa","actualMolecularWeight":null,"aminoAcidEnd":263,"aminoAcidStart":31,"nature":"Recombinant","expressionSystem":"CHO cells","accessionNumber":"Q2MKA7","tags":[]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon reconstitution add a carrier protein (0.1% BSA)
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

RSPO1 also known as R-spondin 1 is a protein that plays an important role in the activation of the Wnt/β-catenin signaling pathway. It weighs approximately 29 kDa. RSPO1 is a secreted protein and is expressed in a variety of tissues including the ovary pancreas and regions of the brain. By binding to the leucine-rich repeat-containing G-protein-coupled receptors (LGRs) especially LGR4 LGR5 and LGR6 RSPO1 enhances Wnt signaling activity leading to increased stability and accumulation of β-catenin in the cell.
Biological function summary

RSPO1 acts as a major stimulator of cell proliferation and differentiation. It does not function alone but rather works in association with the Wnt receptors for signal enhancement. RSPO1 positively influences the regenerative processes in tissues and organs contributing to cell fate determination during development. As part of this interaction RSPO1 can reverse the degradation of Wnt receptors therefore amplifying the signaling required for proper developmental processes and tissue maintenance.

Pathways

RSPO1 integrates deeply into the Wnt/β-catenin signaling pathway where its role is important for amplifying the signals important for cellular activities such as proliferation and migration. RSPO1 interacts with pathway members such as Frizzled receptors and lipoprotein receptor-related proteins (Lrp5/6) to potentiate Wnt signaling. The function of RSPO1 in the Wnt pathway aligns with its interplay in epithelial cell stimulation and development making it an essential component in pathways driving cellular growth and differentiation.

RSPO1 has significant connections with congenital and proliferative conditions. Disruptions in RSPO1 expression are linked to sex reversal syndrome where the genetic sex does not match the phenotypic sex due to abnormal gonadal development. Additionally RSPO1 is implicated in colorectal cancer where upregulated Wnt signaling facilitated by RSPO1 promotes unchecked cellular proliferation. The interplay between RSPO1 and other pathway components like β-catenin and Frizzled receptors exacerbates these molecular dysfunctions highlighting its relevance in disease mechanisms.

Specifications

Form

Lyophilized

General info

Function

Activator of the canonical Wnt signaling pathway by acting as a ligand for LGR4-6 receptors (PubMed : 29769720). Upon binding to LGR4-6 (LGR4, LGR5 or LGR6), LGR4-6 associate with phosphorylated LRP6 and frizzled receptors that are activated by extracellular Wnt receptors, triggering the canonical Wnt signaling pathway to increase expression of target genes. Also regulates the canonical Wnt/beta-catenin-dependent pathway and non-canonical Wnt signaling by acting as an inhibitor of ZNRF3, an important regulator of the Wnt signaling pathway. Acts as a ligand for frizzled FZD8 and LRP6. May negatively regulate the TGF-beta pathway. Has a essential roles in ovary determination. Regulates Wnt signaling by antagonizing DKK1/KREM1-mediated internalization of LRP6 through an interaction with KREM1 (PubMed : 17804805).

Sequence similarities

Belongs to the R-spondin family.

Post-translational modifications

C-, and N-glycosylated. N-glycosylation at Asn-137, negatively influences its secretion and enhancing effect on Wnt/beta-catenin signaling (PubMed:27123103). C-mannosylation at Trp-156 by DPY19L3 is required for its secretion and regulates the enhancing activity of Wnt signaling (PubMed:26764097).

Subcellular localisation

Nucleus

Product protocols

Target data

Activator of the canonical Wnt signaling pathway by acting as a ligand for LGR4-6 receptors (PubMed : 29769720). Upon binding to LGR4-6 (LGR4, LGR5 or LGR6), LGR4-6 associate with phosphorylated LRP6 and frizzled receptors that are activated by extracellular Wnt receptors, triggering the canonical Wnt signaling pathway to increase expression of target genes. Also regulates the canonical Wnt/beta-catenin-dependent pathway and non-canonical Wnt signaling by acting as an inhibitor of ZNRF3, an important regulator of the Wnt signaling pathway. Acts as a ligand for frizzled FZD8 and LRP6. May negatively regulate the TGF-beta pathway. Has a essential roles in ovary determination. Regulates Wnt signaling by antagonizing DKK1/KREM1-mediated internalization of LRP6 through an interaction with KREM1 (PubMed : 17804805).
See full target information R-spondin-1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com