JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB276367

Recombinant human RSPO3 protein (His tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human RSPO3 protein (His tag) is a Human Fragment protein, in the 1 to 146 aa range, expressed in HEK 293 cells, with >96%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS.

View Alternative Names

PWTSR, THSD2, RSPO3, R-spondin-3, Protein with TSP type-1 repeat, Roof plate-specific spondin-3, Thrombospondin type-1 domain-containing protein 2, hPWTSR, hRspo3

2 Images
Functional Studies - Recombinant human RSPO3 protein (His tag) (AB276367)
  • FuncS

Supplier Data

Functional Studies - Recombinant human RSPO3 protein (His tag) (AB276367)

Measured by its binding ability in a functional ELISA. Immobilized RSPO3-His (146) at 10 μg/mL (100 μL/well) can bind human RNF43-Fc. The EC50 of human RNF43-Fc is 0.01-0.03 μg/mL.

SDS-PAGE - Recombinant human RSPO3 protein (His tag) (AB276367)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant human RSPO3 protein (His tag) (AB276367)

SDS-PAGE analysis of ab276367.

Key facts

Purity

>96% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

HEK 293 cells

Tags

His tag C-Terminus

Applications

FuncS, SDS-PAGE

applications

Biologically active

Yes

Biological activity

Measured by its binding ability in a functional ELISA. Immobilized RSPO3-His (146) at 10 μg/mL (100 μL/well) can bind human RNF43-Fc. The EC50 of human RNF43-Fc is 0.01-0.03 μg/mL.

Accession

Q9BXY4

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: 100% PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MHLRLISWLFIILNFMEYIGSQNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPRLFFALERIGMKQIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYLHLGKCLDNCPEGLEANNHTMECVSIV","proteinLength":"Fragment","predictedMolecularWeight":"15.3 kDa","actualMolecularWeight":null,"aminoAcidEnd":146,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q9BXY4","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

R-spondin 3 (RSPO3) also known as CRISTIN3 is a protein with a molecular weight of approximately 27 kDa. Mechanically RSPO3 acts as a regulatory protein involved in modulating the Wnt signaling pathway by facilitating the interaction between LGR receptors and Frizzled LRP6 co-receptors. RSPO3 is expressed in various tissues with high levels observed in the placenta and also in the lung and kidney. This distribution suggests RSPO3 has diverse roles in different physiological contexts.
Biological function summary

RSPO3 functions as a growth factor-like protein that can enhance Wnt signaling leading to the stabilization of β-catenin and promoting cell proliferation and differentiation. RSPO3 is part of a larger protein complex that includes LGR4/5/6 receptors and the Wnt signaling ligands. This interaction is essential in processes like embryonic development and tissue regeneration illustrating its supportive role in maintaining cellular dynamics.

Pathways

RSPO3 plays a significant role in the Wnt/β-catenin signaling pathway where it works closely with proteins such as LRP6 and Frizzled receptors. It also connects with the non-canonical Wnt signaling pathway. This interaction enhances signal transduction vital for cell fate determination. RSPO3’s ability to bind LGR4 and facilitate its role in pathways related to growth and development emphasizes its importance in cellular communication and regulation.

Aberrant expression or mutations of RSPO3 have associations with cancer particularly colorectal cancer through alterations in the Wnt/β-catenin pathway. RSPO3 supports oncogenic processes by enhancing β-catenin stability leading to uncontrolled cell proliferation. It is also relevant in vascular diseases where its interaction with other proteins like VEGFA can influence angiogenesis. Understanding RSPO3’s function in these pathways aids in developing targeted therapies for these conditions.

Specifications

Form

Lyophilized

General info

Function

Activator of the canonical Wnt signaling pathway by acting as a ligand for LGR4-6 receptors, which acts as a key regulator of angiogenesis. Upon binding to LGR4-6 (LGR4, LGR5 or LGR6), LGR4-6 associate with phosphorylated LRP6 and frizzled receptors that are activated by extracellular Wnt receptors, triggering the canonical Wnt signaling pathway to increase expression of target genes. Also regulates the canonical Wnt/beta-catenin-dependent pathway and non-canonical Wnt signaling by acting as an inhibitor of ZNRF3, an important regulator of the Wnt signaling pathway. Acts as a ligand for frizzled FZD8 and LRP6. May negatively regulate the TGF-beta pathway (PubMed : 21727895, PubMed : 21909076, PubMed : 22615920). Acts as a key regulator of angiogenesis by controlling vascular stability and pruning : acts by activating the non-canonical Wnt signaling pathway in endothelial cells (By similarity) (PubMed : 21727895, PubMed : 21909076, PubMed : 22615920). Can also amplify Wnt signaling pathway independently of LGR4-6 receptors, possibly by acting as a direct antagonistic ligand to RNF43 and ZNRF3 (PubMed : 29769720).

Sequence similarities

Belongs to the R-spondin family.

Product protocols

Target data

Activator of the canonical Wnt signaling pathway by acting as a ligand for LGR4-6 receptors, which acts as a key regulator of angiogenesis. Upon binding to LGR4-6 (LGR4, LGR5 or LGR6), LGR4-6 associate with phosphorylated LRP6 and frizzled receptors that are activated by extracellular Wnt receptors, triggering the canonical Wnt signaling pathway to increase expression of target genes. Also regulates the canonical Wnt/beta-catenin-dependent pathway and non-canonical Wnt signaling by acting as an inhibitor of ZNRF3, an important regulator of the Wnt signaling pathway. Acts as a ligand for frizzled FZD8 and LRP6. May negatively regulate the TGF-beta pathway (PubMed : 21727895, PubMed : 21909076, PubMed : 22615920). Acts as a key regulator of angiogenesis by controlling vascular stability and pruning : acts by activating the non-canonical Wnt signaling pathway in endothelial cells (By similarity) (PubMed : 21727895, PubMed : 21909076, PubMed : 22615920). Can also amplify Wnt signaling pathway independently of LGR4-6 receptors, possibly by acting as a direct antagonistic ligand to RNF43 and ZNRF3 (PubMed : 29769720).
See full target information RSPO3

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com