JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB112260

Recombinant Human RUNX1 / AML1 protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human RUNX1 / AML1 protein (GST tag N-Terminus) is a Human Fragment protein, in the 210 to 311 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

AML1, CBFA2, RUNX1, Runt-related transcription factor 1, Acute myeloid leukemia 1 protein, Core-binding factor subunit alpha-2, Oncogene AML-1, Polyomavirus enhancer-binding protein 2 alpha B subunit, SL3-3 enhancer factor 1 alpha B subunit, SL3/AKV core-binding factor alpha B subunit, CBF-alpha-2, PEA2-alpha B, PEBP2-alpha B

1 Images
SDS-PAGE - Recombinant Human RUNX1 / AML1 protein (GST tag N-Terminus) (AB112260)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human RUNX1 / AML1 protein (GST tag N-Terminus) (AB112260)

Coomassie Blue stained 12.5% SDS page analysis of ab112260

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, ELISA, SDS-PAGE

applications

Biologically active

No

Accession

Q01196

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"RVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPATPISPGRASGMTTLSAELSSRLSTAPDLTAFSDPRQFP","proteinLength":"Fragment","predictedMolecularWeight":"37.22 kDa","actualMolecularWeight":null,"aminoAcidEnd":311,"aminoAcidStart":210,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q01196","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

RUNX1 also known as AML1 is a transcription factor with a molecular weight of approximately 48 kDa. It belongs to the Runt-related transcription factor family and plays a critical role in hematopoiesis. RUNX1 is expressed in hematopoietic stem cells and various other tissues where it regulates the expression of genes involved in the differentiation and proliferation of blood cells. It exerts its function by binding to specific DNA sequences thereby controlling the transcriptional activity necessary for normal hematopoietic development.
Biological function summary

RUNX1 is essential in the formation of blood cells and is part of the core-binding factor (CBF) complex. This complex is a heterodimer comprising RUNX1 and the CBFβ subunit. The interaction between RUNX1 and CBFβ stabilizes the DNA binding capability of RUNX1 facilitating the activation of target gene transcription. The proper functioning of RUNX1 is necessary for the maintenance of normal lineage specification of hematopoietic progenitors affecting both myeloid and lymphoid cell lineages.

Pathways

RUNX1 plays a significant role in the Wnt signaling pathway and the TGF-beta signaling pathway. RUNX1 interacts with several proteins in these pathways including SMAD proteins and β-catenin which are important for transmitting extracellular signals that regulate cell growth and differentiation. RUNX1’s role in these pathways highlights its importance not only in hematopoiesis but also in preventing abnormal cell proliferation.

RUNX1 mutations are strongly associated with acute myeloid leukemia (AML) and familial platelet disorder. In AML RUNX1 mutations disrupt normal hematopoiesis leading to the uncontrolled proliferation of immature blood cells. RUNX1-related proteins such as the GM-CSF receptor can contribute to disease progression by altering cytokine signaling. RUNX1's involvement in familial platelet disorder reflects its importance in maintaining normal blood cell counts and function as loss of RUNX1 function leads to predisposition to leukemia.

Specifications

Form

Liquid

General info

Function

Forms the heterodimeric complex core-binding factor (CBF) with CBFB. RUNX members modulate the transcription of their target genes through recognizing the core consensus binding sequence 5'-TGTGGT-3', or very rarely, 5'-TGCGGT-3', within their regulatory regions via their runt domain, while CBFB is a non-DNA-binding regulatory subunit that allosterically enhances the sequence-specific DNA-binding capacity of RUNX. The heterodimers bind to the core site of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, LCK, IL3 and GM-CSF promoters (Probable). Essential for the development of normal hematopoiesis (PubMed : 17431401). Acts synergistically with ELF4 to transactivate the IL-3 promoter and with ELF2 to transactivate the BLK promoter (PubMed : 10207087, PubMed : 14970218). Inhibits KAT6B-dependent transcriptional activation (By similarity). Involved in lineage commitment of immature T cell precursors. CBF complexes repress ZBTB7B transcription factor during cytotoxic (CD8+) T cell development. They bind to RUNX-binding sequence within the ZBTB7B locus acting as transcriptional silencer and allowing for cytotoxic T cell differentiation. CBF complexes binding to the transcriptional silencer is essential for recruitment of nuclear protein complexes that catalyze epigenetic modifications to establish epigenetic ZBTB7B silencing (By similarity). Controls the anergy and suppressive function of regulatory T-cells (Treg) by associating with FOXP3. Activates the expression of IL2 and IFNG and down-regulates the expression of TNFRSF18, IL2RA and CTLA4, in conventional T-cells (PubMed : 17377532). Positively regulates the expression of RORC in T-helper 17 cells (By similarity).. Isoform AML-1G shows higher binding activities for target genes and binds TCR-beta-E2 and RAG-1 target site with threefold higher affinity than other isoforms. It is less effective in the context of neutrophil terminal differentiation.. Isoform AML-1L interferes with the transactivation activity of RUNX1.

Post-translational modifications

Phosphorylated in its C-terminus upon IL-6 treatment. Phosphorylation enhances interaction with KAT6A.. Methylated.. Phosphorylated in Ser-249 Thr-273 and Ser-276 by HIPK2 when associated with CBFB and DNA. This phosphorylation promotes subsequent EP300 phosphorylation.

Product protocols

Target data

Forms the heterodimeric complex core-binding factor (CBF) with CBFB. RUNX members modulate the transcription of their target genes through recognizing the core consensus binding sequence 5'-TGTGGT-3', or very rarely, 5'-TGCGGT-3', within their regulatory regions via their runt domain, while CBFB is a non-DNA-binding regulatory subunit that allosterically enhances the sequence-specific DNA-binding capacity of RUNX. The heterodimers bind to the core site of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, LCK, IL3 and GM-CSF promoters (Probable). Essential for the development of normal hematopoiesis (PubMed : 17431401). Acts synergistically with ELF4 to transactivate the IL-3 promoter and with ELF2 to transactivate the BLK promoter (PubMed : 10207087, PubMed : 14970218). Inhibits KAT6B-dependent transcriptional activation (By similarity). Involved in lineage commitment of immature T cell precursors. CBF complexes repress ZBTB7B transcription factor during cytotoxic (CD8+) T cell development. They bind to RUNX-binding sequence within the ZBTB7B locus acting as transcriptional silencer and allowing for cytotoxic T cell differentiation. CBF complexes binding to the transcriptional silencer is essential for recruitment of nuclear protein complexes that catalyze epigenetic modifications to establish epigenetic ZBTB7B silencing (By similarity). Controls the anergy and suppressive function of regulatory T-cells (Treg) by associating with FOXP3. Activates the expression of IL2 and IFNG and down-regulates the expression of TNFRSF18, IL2RA and CTLA4, in conventional T-cells (PubMed : 17377532). Positively regulates the expression of RORC in T-helper 17 cells (By similarity).. Isoform AML-1G shows higher binding activities for target genes and binds TCR-beta-E2 and RAG-1 target site with threefold higher affinity than other isoforms. It is less effective in the context of neutrophil terminal differentiation.. Isoform AML-1L interferes with the transactivation activity of RUNX1.
See full target information RUNX1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com