JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB95893

Recombinant Human RUNX3 protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human RUNX3 protein (His tag N-Terminus) is a Human Fragment protein, in the 53 to 186 aa range, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

AML2, CBFA3, PEBP2A3, RUNX3, Runt-related transcription factor 3, Acute myeloid leukemia 2 protein, Core-binding factor subunit alpha-3, Oncogene AML-2, Polyomavirus enhancer-binding protein 2 alpha C subunit, SL3-3 enhancer factor 1 alpha C subunit, SL3/AKV core-binding factor alpha C subunit, CBF-alpha-3, PEA2-alpha C, PEBP2-alpha C

1 Images
SDS-PAGE - Recombinant Human RUNX3 protein (His tag N-Terminus) (AB95893)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human RUNX3 protein (His tag N-Terminus) (AB95893)

15% SDS-PAGE showing ab95893 at approximately 17.1kDa (3μg).

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

Q13761

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.58% Sodium chloride, 0.316% Tris HCl, 0.0154% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMRSMVDVLADHAGELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGDVPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPTQVATYHRAIKVTVDGPREPRRHRQK","proteinLength":"Fragment","predictedMolecularWeight":"17.1 kDa","actualMolecularWeight":null,"aminoAcidEnd":186,"aminoAcidStart":53,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q13761","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

RUNX3 also known as Runt-related transcription factor 3 is a protein that plays an important role in regulating gene expression. The protein has a mass of approximately 44 kDa. RUNX3 is found mainly in tissues like the gastrointestinal tract and neural systems. It functions as a DNA-binding transcription factor that regulates various genes responsible for important cellular processes.
Biological function summary

The function of RUNX3 involves the regulation of cell proliferation differentiation and apoptosis. RUNX3 often forms a complex with the core-binding factor beta (CBFβ) enhancing its stability and DNA-binding capability. This protein is essential in maintaining cellular homeostasis and influencing the immune response particularly through its role in T cell development.

Pathways

RUNX3 is heavily involved in the TGF-beta signaling pathway and the Wnt signaling pathway. It interacts with several proteins such as SMADs in the TGF-beta pathway to modulate gene expression that affects cell growth and survival. Interaction with beta-catenin in the Wnt signaling pathway further emphasizes its importance in regulating cell fate decisions.

Alterations in RUNX3 expression or function are linked to cancer including gastric cancer and colorectal cancer. It often shows reduced activity or expression in these cancers which associates with proteins like TGF-beta leading to impaired cell growth control. RUNX3 dysregulation is also connected to neurological disorders due to its role in neural development and function.

Specifications

Form

Liquid

Additional notes

ab95893 is purified using conventional chromatography techniques.

General info

Function

Forms the heterodimeric complex core-binding factor (CBF) with CBFB. RUNX members modulate the transcription of their target genes through recognizing the core consensus binding sequence 5'-TGTGGT-3', or very rarely, 5'-TGCGGT-3', within their regulatory regions via their runt domain, while CBFB is a non-DNA-binding regulatory subunit that allosterically enhances the sequence-specific DNA-binding capacity of RUNX. The heterodimers bind to the core site of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, LCK, IL3 and GM-CSF promoters (By similarity). May be involved in the control of cellular proliferation and/or differentiation. In association with ZFHX3, up-regulates CDKN1A promoter activity following TGF-beta stimulation (PubMed : 20599712). CBF complexes repress ZBTB7B transcription factor during cytotoxic (CD8+) T cell development. They bind to RUNX-binding sequence within the ZBTB7B locus acting as transcriptional silencer and allowing for cytotoxic T cell differentiation. CBF complexes binding to the transcriptional silencer is essential for recruitment of nuclear protein complexes that catalyze epigenetic modifications to establish epigenetic ZBTB7B silencing (By similarity).

Post-translational modifications

Phosphorylated on tyrosine residues by SRC. Phosphorylated by LCK and FYN.

Subcellular localisation

Nucleus

Product protocols

Target data

Forms the heterodimeric complex core-binding factor (CBF) with CBFB. RUNX members modulate the transcription of their target genes through recognizing the core consensus binding sequence 5'-TGTGGT-3', or very rarely, 5'-TGCGGT-3', within their regulatory regions via their runt domain, while CBFB is a non-DNA-binding regulatory subunit that allosterically enhances the sequence-specific DNA-binding capacity of RUNX. The heterodimers bind to the core site of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, LCK, IL3 and GM-CSF promoters (By similarity). May be involved in the control of cellular proliferation and/or differentiation. In association with ZFHX3, up-regulates CDKN1A promoter activity following TGF-beta stimulation (PubMed : 20599712). CBF complexes repress ZBTB7B transcription factor during cytotoxic (CD8+) T cell development. They bind to RUNX-binding sequence within the ZBTB7B locus acting as transcriptional silencer and allowing for cytotoxic T cell differentiation. CBF complexes binding to the transcriptional silencer is essential for recruitment of nuclear protein complexes that catalyze epigenetic modifications to establish epigenetic ZBTB7B silencing (By similarity).
See full target information RUNX3

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com