JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB222425

Recombinant Human S100 beta protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human S100 beta protein is a Human Full Length protein, in the 1 to 92 aa range, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE.

View Alternative Names

Protein S100-B, S-100 protein beta chain, S-100 protein subunit beta, S100 calcium-binding protein B, S100B

1 Images
SDS-PAGE - Recombinant Human S100 beta protein (AB222425)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human S100 beta protein (AB222425)

15% SDS-PAGE analysis of 3 μg ab222425.

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

Tag free

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P04271

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: PBS, 10% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE","proteinLength":"Full Length","predictedMolecularWeight":"10.7 kDa","actualMolecularWeight":null,"aminoAcidEnd":92,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P04271","tags":[]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

S100 beta also known as protein S100 is part of the S100 family of proteins characterized by their calcium-binding properties. The S100 beta protein has an approximate molecular mass of 10.7 kDa. This protein is mainly expressed in astrocytes a type of glial cell in the central nervous system. It acts as a marker for astrocytes and is prominently used in astrocyte immunohistochemistry. Additionally it serves as a valuable marker for identifying and studying astrocyte markers because it can highlight the presence of these cells in various contexts.
Biological function summary

The S100 beta protein participates in several intracellular and extracellular activities influencing cell proliferation and differentiation. It forms dimers and sometimes assembles into larger complexes mediated by the binding of calcium ions which alters its functional state. Within the nervous system S100 beta modulates the dynamics between neurons and glial cells affecting processes such as cell survival and neurite outgrowth. This dual role in both supporting and inhibiting various cellular actions highlights its importance in maintaining neural homeostasis.

Pathways

S100 beta engages in signaling pathways related to inflammation and stress responses. It works within the MAPK and NF-kB pathways playing roles in cellular responses to oxidative stress. These pathways involve interactions with other proteins like p53 which S100 beta can modulate to influence apoptosis. The regulatory properties of S100 beta in these pathways link it with broader networks affecting cell fate decisions under pathological and physiological conditions.

S100 beta is associated with neurodegenerative diseases and cancer. Elevated levels of S100 beta are often found in Alzheimer's disease where it interacts with proteins like amyloid-beta contributing to neuroinflammation and neurotoxicity. In cancer particularly malignant melanoma S100 beta levels serve as a biomarker for tumor progression. Its interactions with p53 and other regulatory proteins highlight its involvement in oncogenic processes emphasizing its potential as a target for therapeutic intervention in these diseases.

Specifications

Form

Liquid

Additional notes

ab222425 was purified using conventional chromatography techniques.

General info

Function

Small zinc- and- and calcium-binding protein that is highly expressed in astrocytes and constitutes one of the most abundant soluble proteins in brain (PubMed : 20950652, PubMed : 6487634). Weakly binds calcium but binds zinc very tightly-distinct binding sites with different affinities exist for both ions on each monomer (PubMed : 20950652, PubMed : 6487634). Physiological concentrations of potassium ion antagonize the binding of both divalent cations, especially affecting high-affinity calcium-binding sites (By similarity). Acts as a neurotrophic factor that promotes astrocytosis and axonal proliferation (By similarity). Involved in innervation of thermogenic adipose tissue by acting as an adipocyte-derived neurotrophic factor that promotes sympathetic innervation of adipose tissue (By similarity). Binds to and initiates the activation of STK38 by releasing autoinhibitory intramolecular interactions within the kinase (By similarity). Interaction with AGER after myocardial infarction may play a role in myocyte apoptosis by activating ERK1/2 and p53/TP53 signaling (By similarity). Could assist ATAD3A cytoplasmic processing, preventing aggregation and favoring mitochondrial localization (PubMed : 20351179). May mediate calcium-dependent regulation on many physiological processes by interacting with other proteins, such as TPR-containing proteins, and modulating their activity (PubMed : 22399290).

Sequence similarities

Belongs to the S-100 family.

Subcellular localisation

Nucleus

Product protocols

Target data

Small zinc- and- and calcium-binding protein that is highly expressed in astrocytes and constitutes one of the most abundant soluble proteins in brain (PubMed : 20950652, PubMed : 6487634). Weakly binds calcium but binds zinc very tightly-distinct binding sites with different affinities exist for both ions on each monomer (PubMed : 20950652, PubMed : 6487634). Physiological concentrations of potassium ion antagonize the binding of both divalent cations, especially affecting high-affinity calcium-binding sites (By similarity). Acts as a neurotrophic factor that promotes astrocytosis and axonal proliferation (By similarity). Involved in innervation of thermogenic adipose tissue by acting as an adipocyte-derived neurotrophic factor that promotes sympathetic innervation of adipose tissue (By similarity). Binds to and initiates the activation of STK38 by releasing autoinhibitory intramolecular interactions within the kinase (By similarity). Interaction with AGER after myocardial infarction may play a role in myocyte apoptosis by activating ERK1/2 and p53/TP53 signaling (By similarity). Could assist ATAD3A cytoplasmic processing, preventing aggregation and favoring mitochondrial localization (PubMed : 20351179). May mediate calcium-dependent regulation on many physiological processes by interacting with other proteins, such as TPR-containing proteins, and modulating their activity (PubMed : 22399290).
See full target information S100B

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com