JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB103393

Recombinant Human S100A12/CGRP protein

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant Human S100A12/CGRP protein is a Human Full Length protein, in the 2 to 92 aa range, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE, WB.

View Alternative Names

Protein S100-A12, CGRP, Calcium-binding protein in amniotic fluid 1, Calgranulin-C, Extracellular newly identified RAGE-binding protein, Migration inhibitory factor-related protein 6, Neutrophil S100 protein, S100 calcium-binding protein A12, CAAF1, CAGC, EN-RAGE, MRP-6, p6, S100A12

1 Images
SDS-PAGE - Recombinant Human S100A12/CGRP protein (AB103393)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human S100A12/CGRP protein (AB103393)

14% SDS-PAGE analysis of 5 μg ab103393
Lane 1 : reduced and heated sample
Lane 2 : non reduced and non heated sample

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

WB, SDS-PAGE

applications

Biologically active

No

Accession

P80511

Animal free

No

Carrier free

No

Species

Human

Reconstitution

Reconstitute at 0.5 mg/mL in water

Storage buffer

Constituents: 0.29% Sodium chloride, 0.242% Tris

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This product was previously labelled as S100A12

Sequence info

[{"sequence":"MKHHHHHHASTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE","proteinLength":"Full Length","predictedMolecularWeight":"11.6 kDa","actualMolecularWeight":null,"aminoAcidEnd":92,"aminoAcidStart":2,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P80511","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The S100A12 protein also known as Calgranulin C or CGRP (Calcitonin Gene-Related Peptide) has a molecular mass of approximately 10.4 kDa. This protein shows expression primarily in neutrophils but is also present in other types of cells such as epithelial cells and certain cell lines. S100A12 belongs to the S100 protein family which is part of the EF-hand calcium-binding proteins known for playing roles in cell regulation. The protein binds calcium ions which influence its structural conformation.
Biological function summary

S100A12 is important in the inflammatory response and immune system regulation. It acts as a pro-inflammatory mediator attracting leukocytes to sites of inflammation. Furthermore it can bind to receptors on cell surfaces like RAGE (Receptor for Advanced Glycation End Products) which induces signaling cascades that amplify immune responses. S100A12 does not function alone but often forms homodimers or heterodimers with other S100 proteins enhancing its biological activities.

Pathways

S100A12 participates in pathways like the inflammatory response pathway and the RAGE signaling pathway. By interacting with RAGE and possibly other receptors it impacts cellular responses associated with stress injury and microbial infection. This interaction connects S100A12 to other proteins in the same pathways such as NF-kB an important transcription factor involved in inflammation and immune responses.

S100A12 has connections with conditions like rheumatoid arthritis and inflammatory bowel disease. Elevated levels of S100A12 often correlate with disease activity and severity suggesting its potential as a biomarker. In rheumatoid arthritis it contributes to the inflammatory environment while in inflammatory bowel disease it associates not only with inflammation but also with proteins like IL-6 and TNF-alpha which are significant cytokines in the pathogenesis of these diseases.

Specifications

Form

Lyophilized

General info

Function

S100A12 is a calcium-, zinc- and copper-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response. Its pro-inflammatory activity involves recruitment of leukocytes, promotion of cytokine and chemokine production, and regulation of leukocyte adhesion and migration. Acts as an alarmin or a danger associated molecular pattern (DAMP) molecule and stimulates innate immune cells via binding to receptor for advanced glycation endproducts (AGER). Binding to AGER activates the MAP-kinase and NF-kappa-B signaling pathways leading to production of pro-inflammatory cytokines and up-regulation of cell adhesion molecules ICAM1 and VCAM1. Acts as a monocyte and mast cell chemoattractant. Can stimulate mast cell degranulation and activation which generates chemokines, histamine and cytokines inducing further leukocyte recruitment to the sites of inflammation. Can inhibit the activity of matrix metalloproteinases; MMP2, MMP3 and MMP9 by chelating Zn(2+) from their active sites. Possesses filariacidal and filariastatic activity. Calcitermin possesses antifungal activity against C.albicans and is also active against E.coli and P.aeruginosa but not L.monocytogenes and S.aureus.

Sequence similarities

Belongs to the S-100 family.

Subcellular localisation

Cytoskeleton

Product protocols

Target data

S100A12 is a calcium-, zinc- and copper-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response. Its pro-inflammatory activity involves recruitment of leukocytes, promotion of cytokine and chemokine production, and regulation of leukocyte adhesion and migration. Acts as an alarmin or a danger associated molecular pattern (DAMP) molecule and stimulates innate immune cells via binding to receptor for advanced glycation endproducts (AGER). Binding to AGER activates the MAP-kinase and NF-kappa-B signaling pathways leading to production of pro-inflammatory cytokines and up-regulation of cell adhesion molecules ICAM1 and VCAM1. Acts as a monocyte and mast cell chemoattractant. Can stimulate mast cell degranulation and activation which generates chemokines, histamine and cytokines inducing further leukocyte recruitment to the sites of inflammation. Can inhibit the activity of matrix metalloproteinases; MMP2, MMP3 and MMP9 by chelating Zn(2+) from their active sites. Possesses filariacidal and filariastatic activity. Calcitermin possesses antifungal activity against C.albicans and is also active against E.coli and P.aeruginosa but not L.monocytogenes and S.aureus.
See full target information S100A12

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

Annals of clinical biochemistry 51:248-57 PubMed23982266

2013

Soluble form of receptor for advanced glycation end-products (sRAGE): do sRAGE ligands or anti-sRAGE auto-antibodies interfere with sRAGE quantification?

Applications

Unspecified application

Species

Unspecified reactive species

Rodrigo Lorenzi,Nicolas Grossin,Marc Lambert,Maité Daroux,Zoubir Adjoutah,Christophe Flahaut,Philippe Jacolot,Frédéric J Tessier,Didier Lefranc,Pierre Desremaux,Sylvain Dubucquoi,Eric Boulanger
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com