JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB290059

Recombinant Human S100A4 Protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human S100A4 Protein is a Human Full Length protein, in the 2 to 101 aa range, expressed in HEK 293 cells, with >95%, <0.005 EU/µg endotoxin level.

View Alternative Names

CAPL, MTS1, S100A4, Protein S100-A4, Calvasculin, Metastasin, Placental calcium-binding protein, Protein Mts1, S100 calcium-binding protein A4

3 Images
Mass Spectrometry - Recombinant Human S100A4 Protein (AB290059)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Human S100A4 Protein (AB290059)

Mass determination by ESI-TOF.

Predicted MW is 11654.38 Da. (+/- 10 Da by ESI-TOF). Observed MW is 11398.23 Da.

HPLC - Recombinant Human S100A4 Protein (AB290059)
  • HPLC

Supplier Data

HPLC - Recombinant Human S100A4 Protein (AB290059)

HPLC analysis of ab290059

SDS-PAGE - Recombinant Human S100A4 Protein (AB290059)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human S100A4 Protein (AB290059)

SDS-PAGE analysis of ab290059

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

<0.005 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Biologically active

No

Accession

P26447

Animal free

No

Carrier free

No

Species

Human

Reconstitution

Reconstitute in PBS

Storage buffer

pH: 7.4 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Sequence info

[{"sequence":"ACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":101,"aminoAcidStart":2,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P26447","tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

S100A4 also known as metastasin or MTS1 is a protein with a molecular weight of approximately 12 kDa. It functions by binding calcium which induces conformational changes aiding in its interaction with target proteins. S100A4 is part of the S100 family of proteins characterized by two EF-hand calcium-binding motifs. Expression of S100A4 is observed in various cell types including fibroblasts endothelial cells and several tumor cells where it contributes to processes like cell motility invasion and angiogenesis.
Biological function summary

The role of S100A4 extends beyond mere calcium binding; it associates with the cytoskeleton promoting cell structures related to movement and metastasis. It does not act alone but often partners with proteins like myosin IIA to regulate cytoskeletal dynamics. Additionally S100A4 modulates extracellular matrix components and interacts with signaling pathways that control cancer progression making it significant in both normal physiological contexts and pathological states.

Pathways

Functional activities of S100A4 integrate into important pathways involved in cellular movement and metastasis. S100A4 plays roles in the regulation of the Wnt/β-catenin pathway which is pivotal for cell-cell interaction and fate determination. It also interacts with matrix metalloproteinases like MMPs thereby managing processes of tissue invasion and remodeling essential in cancer metastasis. Other pathways influencing cell adhesion and signal transduction may indirectly involve S100A4 through related proteins.

Elevated S100A4 levels have implications in cancer particularly in enhancing metastasis in breast and colorectal cancers. The protein promotes tumor developments by inducing changes in the tumor microenvironment making it a target of interest in oncology. S100A4 also interacts with proteins like p53 and β-catenin which are critical in the pathology of tumors. Moreover S100A4 contributes to fibrotic diseases accentuating tissue remodeling activities by modulating fibroblast behavior and extracellular matrix deposition.

Specifications

Form

Lyophilized

General info

Function

Calcium-binding protein that plays a role in various cellular processes including motility, angiogenesis, cell differentiation, apoptosis, and autophagy (PubMed : 16707441, PubMed : 23752197, PubMed : 30713770). Increases cell motility and invasiveness by interacting with non-muscle myosin heavy chain (NMMHC) IIA/MYH9 (PubMed : 16707441). Mechanistically, promotes filament depolymerization and increases the amount of soluble myosin-IIA, resulting in the formation of stable protrusions facilitating chemotaxis (By similarity). Modulates also the pro-apoptotic function of TP53 by binding to its C-terminal transactivation domain within the nucleus and reducing its protein levels (PubMed : 23752197). Within the extracellular space, stimulates cytokine production including granulocyte colony-stimulating factor and CCL24 from T-lymphocytes (By similarity). In addition, stimulates T-lymphocyte chemotaxis by acting as a chemoattractant complex with PGLYRP1 that promotes lymphocyte migration via CCR5 and CXCR3 receptors (PubMed : 26654597, PubMed : 30713770).

Sequence similarities

Belongs to the S-100 family.

Subcellular localisation

Nucleus

Product protocols

Target data

Calcium-binding protein that plays a role in various cellular processes including motility, angiogenesis, cell differentiation, apoptosis, and autophagy (PubMed : 16707441, PubMed : 23752197, PubMed : 30713770). Increases cell motility and invasiveness by interacting with non-muscle myosin heavy chain (NMMHC) IIA/MYH9 (PubMed : 16707441). Mechanistically, promotes filament depolymerization and increases the amount of soluble myosin-IIA, resulting in the formation of stable protrusions facilitating chemotaxis (By similarity). Modulates also the pro-apoptotic function of TP53 by binding to its C-terminal transactivation domain within the nucleus and reducing its protein levels (PubMed : 23752197). Within the extracellular space, stimulates cytokine production including granulocyte colony-stimulating factor and CCL24 from T-lymphocytes (By similarity). In addition, stimulates T-lymphocyte chemotaxis by acting as a chemoattractant complex with PGLYRP1 that promotes lymphocyte migration via CCR5 and CXCR3 receptors (PubMed : 26654597, PubMed : 30713770).
See full target information S100A4

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com