JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB95909

Recombinant Human S100A9 protein (His tag C-Terminus)

Be the first to review this product! Submit a review

|

(4 Publications)

Recombinant Human S100A9 protein (His tag C-Terminus) is a Human Full Length protein, in the 1 to 114 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec, WB.

View Alternative Names

CAGB, CFAG, MRP14, S100A9, Protein S100-A9, Calgranulin-B, Calprotectin L1H subunit, Leukocyte L1 complex heavy chain, Migration inhibitory factor-related protein 14, S100 calcium-binding protein A9, MRP-14, p14

2 Images
Western blot - Recombinant Human S100A9 protein (His tag C-Terminus) (AB95909)
  • WB

Supplier Data

Western blot - Recombinant Human S100A9 protein (His tag C-Terminus) (AB95909)

15% SDS-PAGE showing ab95909 at approximately 14.3kDa (3μg).

All lanes:

Western blot - Recombinant Human S100A9 protein (His tag C-Terminus) (ab95909)

false

Western blot - Recombinant Human S100A9 protein (His tag C-Terminus) (AB95909)
  • WB

Unknown

Western blot - Recombinant Human S100A9 protein (His tag C-Terminus) (AB95909)

All lanes:

Western blot - Anti-S100A9 antibody (<a href='/en-us/products/primary-antibodies/s100a9-antibody-ab63818'>ab63818</a>) at 1 µg/mL

All lanes:

Western blot - Recombinant Human S100A9 protein (His tag C-Terminus) (ab95909) at 0.01 µg

Secondary

All lanes:

Western blot - Goat Anti-Rabbit IgG H&L (HRP) preadsorbed (<a href='/en-us/products/secondary-antibodies/goat-rabbit-igg-h-l-hrp-preadsorbed-ab97080'>ab97080</a>) at 1/5000 dilution

Predicted band size: 13 kDa

Observed band size: 15 kDa

true

Exposure time: 1min

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag C-Terminus

Applications

Mass Spec, WB, SDS-PAGE

applications

Biologically active

No

Accession

P06702

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 0.58% Sodium chloride, 0.316% Tris HCl

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>ab95909 can be used as a WB positive control in conjunction with <a href='/en-us/products/primary-antibodies/s100a9-antibody-ab63818'>ab63818</a>.</p>" } } }

Sequence info

[{"sequence":"MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTPLEHHHHHH","proteinLength":"Full Length","predictedMolecularWeight":"14.3 kDa","actualMolecularWeight":null,"aminoAcidEnd":114,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P06702","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

S100A9 also known as calgranulin B or MRP-14 is a calcium-binding protein with a molecular weight of approximately 13 kDa. It belongs to the S100 family and forms part of a heterodimeric complex with S100A8. S100A9 is largely found in myeloid cells such as neutrophils and monocytes. It plays a significant role in the cytosol and can be secreted to the extracellular space under specific stress conditions.
Biological function summary

S100A9 impacts inflammatory responses and immune regulation. It partners with S100A8 to form the calprotectin complex which acts as a strong pro-inflammatory mediator. This complex binds to receptors like RAGE and TLR4 initiating signaling pathways that promote inflammation. S100A9 also participates in leukocyte recruitment and has antimicrobial properties blocking the growth of bacteria and fungi by chelating essential metal ions.

Pathways

Several are influenced by S100A9 including the NF-kB and MAPK signaling pathways. Through its interaction with RAGE and TLR4 receptors S100A9 influences the activation of these pathways which are important in the regulation of inflammatory and immune responses. Other proteins involved in these pathways include MyD88 for TLR4 signaling and various kinases for MAPK signaling positioning S100A9 as an important regulator within the inflammatory networks.

S100A9 links to various inflammatory and autoimmune conditions such as rheumatoid arthritis and inflammatory bowel disease. Increased levels of S100A9 have been observed in these conditions where it augments the inflammatory response. In rheumatoid arthritis for example S100A9 upregulation correlates with increased joint inflammation and damage. The protein’s interaction with S100A8 in these diseases highlights its contribution to the pathogenesis and progression of inflammation-related conditions.

Specifications

Form

Liquid

Additional notes

ab95909 is purified using conventional chromatography techniques.

General info

Function

S100A9 is a calcium- and zinc-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response (PubMed : 12626582, PubMed : 15331440, PubMed : 16258195, PubMed : 19122197, PubMed : 20103766, PubMed : 21325622, PubMed : 8423249). It can induce neutrophil chemotaxis, adhesion, can increase the bactericidal activity of neutrophils by promoting phagocytosis via activation of SYK, PI3K/AKT, and ERK1/2 and can induce degranulation of neutrophils by a MAPK-dependent mechanism (PubMed : 12626582, PubMed : 15331440, PubMed : 20103766). Predominantly found as calprotectin (S100A8/A9) which has a wide plethora of intra- and extracellular functions (PubMed : 16258195, PubMed : 19122197, PubMed : 8423249). The intracellular functions include : facilitating leukocyte arachidonic acid trafficking and metabolism, modulation of the tubulin-dependent cytoskeleton during migration of phagocytes and activation of the neutrophilic NADPH-oxidase (PubMed : 15331440, PubMed : 21325622). Participates also in regulatory T-cell differentiation together with CD69 (PubMed : 26296369). Activates NADPH-oxidase by facilitating the enzyme complex assembly at the cell membrane, transferring arachidonic acid, an essential cofactor, to the enzyme complex and S100A8 contributes to the enzyme assembly by directly binding to NCF2/P67PHOX (PubMed : 15642721, PubMed : 22808130). The extracellular functions involve pro-inflammatory, antimicrobial, oxidant-scavenging and apoptosis-inducing activities (PubMed : 19534726, PubMed : 8423249). Its pro-inflammatory activity includes recruitment of leukocytes, promotion of cytokine and chemokine production, and regulation of leukocyte adhesion and migration (PubMed : 15598812, PubMed : 21487906). Acts as an alarmin or a danger associated molecular pattern (DAMP) molecule and stimulates innate immune cells via binding to pattern recognition receptors such as Toll-like receptor 4 (TLR4) and receptor for advanced glycation endproducts (AGER) (PubMed : 19402754). Binding to TLR4 and AGER activates the MAP-kinase and NF-kappa-B signaling pathways resulting in the amplification of the pro-inflammatory cascade (PubMed : 19402754, PubMed : 22804476). Has antimicrobial activity towards bacteria and fungi and exerts its antimicrobial activity probably via chelation of Zn(2+) which is essential for microbial growth (PubMed : 19087201). Can induce cell death via autophagy and apoptosis and this occurs through the cross-talk of mitochondria and lysosomes via reactive oxygen species (ROS) and the process involves BNIP3 (PubMed : 19935772). Can regulate neutrophil number and apoptosis by an anti-apoptotic effect; regulates cell survival via ITGAM/ITGB and TLR4 and a signaling mechanism involving MEK-ERK (PubMed : 22363402). Its role as an oxidant scavenger has a protective role in preventing exaggerated tissue damage by scavenging oxidants (PubMed : 21912088, PubMed : 22489132). Can act as a potent amplifier of inflammation in autoimmunity as well as in cancer development and tumor spread (PubMed : 16258195). Has transnitrosylase activity; in oxidatively-modified low-densitity lipoprotein (LDL(ox))-induced S-nitrosylation of GAPDH on 'Cys-247' proposed to transfer the NO moiety from NOS2/iNOS to GAPDH via its own S-nitrosylated Cys-3 (PubMed : 25417112). The iNOS-S100A8/A9 transnitrosylase complex is proposed to also direct selective inflammatory stimulus-dependent S-nitrosylation of multiple targets such as ANXA5, EZR, MSN and VIM by recognizing a [IL]-x-C-x-x-[DE] motif (PubMed : 25417112).

Sequence similarities

Belongs to the S-100 family.

Post-translational modifications

Phosphorylated. Phosphorylation inhibits activation of tubulin polymerization.. S-nitrosylation of Cys-3 is implicated in LDL(ox)-induced S-nitrosylation of GAPDH at 'Cys-247' through a transnitrosylase mechanism involving a iNOS-S100A8/9 complex (PubMed:25417112).. Methylation at His-105 by METTL9 reduces zinc-binding without affecting heterodimerization with S100A8.

Subcellular localisation

Cytoskeleton

Product protocols

Target data

S100A9 is a calcium- and zinc-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response (PubMed : 12626582, PubMed : 15331440, PubMed : 16258195, PubMed : 19122197, PubMed : 20103766, PubMed : 21325622, PubMed : 8423249). It can induce neutrophil chemotaxis, adhesion, can increase the bactericidal activity of neutrophils by promoting phagocytosis via activation of SYK, PI3K/AKT, and ERK1/2 and can induce degranulation of neutrophils by a MAPK-dependent mechanism (PubMed : 12626582, PubMed : 15331440, PubMed : 20103766). Predominantly found as calprotectin (S100A8/A9) which has a wide plethora of intra- and extracellular functions (PubMed : 16258195, PubMed : 19122197, PubMed : 8423249). The intracellular functions include : facilitating leukocyte arachidonic acid trafficking and metabolism, modulation of the tubulin-dependent cytoskeleton during migration of phagocytes and activation of the neutrophilic NADPH-oxidase (PubMed : 15331440, PubMed : 21325622). Participates also in regulatory T-cell differentiation together with CD69 (PubMed : 26296369). Activates NADPH-oxidase by facilitating the enzyme complex assembly at the cell membrane, transferring arachidonic acid, an essential cofactor, to the enzyme complex and S100A8 contributes to the enzyme assembly by directly binding to NCF2/P67PHOX (PubMed : 15642721, PubMed : 22808130). The extracellular functions involve pro-inflammatory, antimicrobial, oxidant-scavenging and apoptosis-inducing activities (PubMed : 19534726, PubMed : 8423249). Its pro-inflammatory activity includes recruitment of leukocytes, promotion of cytokine and chemokine production, and regulation of leukocyte adhesion and migration (PubMed : 15598812, PubMed : 21487906). Acts as an alarmin or a danger associated molecular pattern (DAMP) molecule and stimulates innate immune cells via binding to pattern recognition receptors such as Toll-like receptor 4 (TLR4) and receptor for advanced glycation endproducts (AGER) (PubMed : 19402754). Binding to TLR4 and AGER activates the MAP-kinase and NF-kappa-B signaling pathways resulting in the amplification of the pro-inflammatory cascade (PubMed : 19402754, PubMed : 22804476). Has antimicrobial activity towards bacteria and fungi and exerts its antimicrobial activity probably via chelation of Zn(2+) which is essential for microbial growth (PubMed : 19087201). Can induce cell death via autophagy and apoptosis and this occurs through the cross-talk of mitochondria and lysosomes via reactive oxygen species (ROS) and the process involves BNIP3 (PubMed : 19935772). Can regulate neutrophil number and apoptosis by an anti-apoptotic effect; regulates cell survival via ITGAM/ITGB and TLR4 and a signaling mechanism involving MEK-ERK (PubMed : 22363402). Its role as an oxidant scavenger has a protective role in preventing exaggerated tissue damage by scavenging oxidants (PubMed : 21912088, PubMed : 22489132). Can act as a potent amplifier of inflammation in autoimmunity as well as in cancer development and tumor spread (PubMed : 16258195). Has transnitrosylase activity; in oxidatively-modified low-densitity lipoprotein (LDL(ox))-induced S-nitrosylation of GAPDH on 'Cys-247' proposed to transfer the NO moiety from NOS2/iNOS to GAPDH via its own S-nitrosylated Cys-3 (PubMed : 25417112). The iNOS-S100A8/A9 transnitrosylase complex is proposed to also direct selective inflammatory stimulus-dependent S-nitrosylation of multiple targets such as ANXA5, EZR, MSN and VIM by recognizing a [IL]-x-C-x-x-[DE] motif (PubMed : 25417112).
See full target information S100A9

Publications (4)

Recent publications for all applications. Explore the full list and refine your search

Journal of biomedical research 39:435-438 PubMed39930660

2025

The presence of glutathione S-transferase in recombinant S100A9 alters its effect on human sperm function.

Applications

Unspecified application

Species

Unspecified reactive species

Estefania Massa,Gastón Prez,Sergio Ghersevich

Acta pharmacologica Sinica 44:105-119 PubMed35732707

2022

Hederacoside C ameliorates colitis via restoring impaired intestinal barrier through moderating S100A9/MAPK and neutrophil recruitment inactivation.

Applications

Unspecified application

Species

Unspecified reactive species

Zheng-Xia Zha,Yu Lin,Ke-Xin Wang,Yan-Lin Zhang,Dan Li,Guo-Qiang Xu,Qiong-Ming Xu,Yan-Li Liu

Chinese medicine 16:11 PubMed33461587

2021

Anemoside B4 ameliorates TNBS-induced colitis through S100A9/MAPK/NF-κB signaling pathway.

Applications

Unspecified application

Species

Unspecified reactive species

Yong Zhang,Zhengxia Zha,Wenhua Shen,Dan Li,Naixin Kang,Zhong Chen,Yanli Liu,Guoqiang Xu,Qiongming Xu

Aging 11:9626-9642 PubMed31727865

2019

Cellular senescence induced by S100A9 in mesenchymal stromal cells through NLRP3 inflammasome activation.

Applications

Unspecified application

Species

Unspecified reactive species

Lei Shi,Youshan Zhao,Chengming Fei,Juan Guo,Yan Jia,Dong Wu,Lingyun Wu,Chunkang Chang
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com