JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB86702

Recombinant Human SAP18 protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human SAP18 protein (His tag N-Terminus) is a Human Full Length protein, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE.

View Alternative Names

GIG38, SAP18, Histone deacetylase complex subunit SAP18, 18 kDa Sin3-associated polypeptide, 2HOR0202, Cell growth-inhibiting gene 38 protein, Sin3-associated polypeptide p18

1 Images
SDS-PAGE - Recombinant Human SAP18 protein (His tag N-Terminus) (AB86702)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human SAP18 protein (His tag N-Terminus) (AB86702)

15% SDS-PAGE showing ab86702 at approximately 19.7kDa (3μg).

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

O00422

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 30% Glycerol (glycerin, glycerine), 0.58% Sodium chloride, 0.316% Tris HCl, 0.0154% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMAVESRVTQEEIKKEPEKPIDREKTCPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFTDVKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPPNRAPPPSGRMRPY","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":0,"aminoAcidStart":0,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"O00422","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The target SAP18 also known as Sin3A-associated protein 18 kDa functions as a part of a critical molecular machinery. With an approximate mass of 18 kilodaltons SAP18 acts as a component of the Sin3A corepressor complex which has roles in the regulation of gene expression. It is expressed in a variety of tissues with significant expression detected in neuronal cells. Through its interaction with other proteins in the complex SAP18 contributes to the repression of specific genes by altering chromatin structure.
Biological function summary

Proteins such as SAP18 influence essential processes by serving as a component of the Sin3A/histone deacetylase (HDAC) complexes. These complexes facilitate transcriptional repression by removing acetyl groups from histone proteins which leads to chromatin condensation and reduced gene activity. SAP18 as part of these complexes aids in regulating genes involved in cell differentiation apoptosis and development. Its role in these processes highlights its importance in maintaining cellular functions and homeostasis.

Pathways

The role of SAP18 in gene expression regulation supports its involvement in key pathways such as cell cycle control and signal transduction. In the context of the cell cycle pathway SAP18 and its complexes work closely with other regulatory proteins like Rb and E2F to ensure proper cell cycle progression by modulating transcription of cycle-dependent genes. In signal transduction pathways SAP18 has the capacity to interact with proteins like HDAC1 influencing the downstream signaling that impacts cell fate decisions.

Researchers have linked SAP18 aberrations to conditions such as cancer and neurodegenerative diseases. In cancer dysregulation of SAP18 expression or function can lead to uncontrolled cell proliferation due to a failure in proper gene repression involving interactions with proteins like HDAC1 and Rb. In neurodegenerative diseases altered SAP18 activity can contribute to neuronal cell death with connections to proteins within the Sin3A/HDAC complex that are important in neuronal survival pathways. These associations highlight SAP18 as a potential therapeutic target in relevant pathological conditions.

Specifications

Form

Liquid

Additional notes

ab86702 is purified using conventional chromatography techniques.Endotoxin level: < 1.0 EU per 1 μg of protein (determined by LAL method).

General info

Function

Component of the SIN3-repressing complex. Enhances the ability of SIN3-HDAC1-mediated transcriptional repression. When tethered to the promoter, it can direct the formation of a repressive complex to core histone proteins. Auxiliary component of the splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junction on mRNAs. The EJC is a dynamic structure consisting of core proteins and several peripheral nuclear and cytoplasmic associated factors that join the complex only transiently either during EJC assembly or during subsequent mRNA metabolism. Component of the ASAP and PSAP complexes which bind RNA in a sequence-independent manner and are proposed to be recruited to the EJC prior to or during the splicing process and to regulate specific excision of introns in specific transcription subsets. The ASAP complex can inhibit mRNA processing during in vitro splicing reactions. The ASAP complex promotes apoptosis and is disassembled after induction of apoptosis. Involved in the splicing modulation of BCL2L1/Bcl-X (and probably other apoptotic genes); specifically inhibits the formation of proapoptotic isoforms such as Bcl-X(S); the activity is different from the established EJC assembly and function.

Sequence similarities

Belongs to the SAP18 family.

Subcellular localisation

Nucleus

Product protocols

Target data

Component of the SIN3-repressing complex. Enhances the ability of SIN3-HDAC1-mediated transcriptional repression. When tethered to the promoter, it can direct the formation of a repressive complex to core histone proteins. Auxiliary component of the splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junction on mRNAs. The EJC is a dynamic structure consisting of core proteins and several peripheral nuclear and cytoplasmic associated factors that join the complex only transiently either during EJC assembly or during subsequent mRNA metabolism. Component of the ASAP and PSAP complexes which bind RNA in a sequence-independent manner and are proposed to be recruited to the EJC prior to or during the splicing process and to regulate specific excision of introns in specific transcription subsets. The ASAP complex can inhibit mRNA processing during in vitro splicing reactions. The ASAP complex promotes apoptosis and is disassembled after induction of apoptosis. Involved in the splicing modulation of BCL2L1/Bcl-X (and probably other apoptotic genes); specifically inhibits the formation of proapoptotic isoforms such as Bcl-X(S); the activity is different from the established EJC assembly and function.
See full target information SAP18

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com