JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB152674

Recombinant Human SC35 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human SC35 protein is a Human Full Length protein, in the 1 to 179 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

SFRS2, SRSF2, Serine/arginine-rich splicing factor 2, Protein PR264, Splicing factor SC35, SC-35

1 Images
SDS-PAGE - Recombinant Human SC35 protein (AB152674)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human SC35 protein (AB152674)

12.5% SDS-PAGE analysis of ab152674 stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

Tag free

Applications

ELISA, SDS-PAGE, WB

applications

Biologically active

No

Accession

Q01130

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGADPGVGAVPGLAADLATAARSLGPALVLDLGRPPSPDPHEGPSPSPRRSPDLVRGPGPGLGPGVLPQCPRGNPNPGRDRRVPPSLLKRKERCPLKKMLRSPV","proteinLength":"Full Length","predictedMolecularWeight":"45.43 kDa","actualMolecularWeight":null,"aminoAcidEnd":179,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q01130","tags":[]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

SC35 also known as SRSF2 (serine/arginine-rich splicing factor 2) is an essential splicing factor with a molecular mass around 26 kDa. This protein is part of the SR protein family which are known for their roles in splicing regulation due to their serine/arginine-rich domains. SC35 predominantly localizes in the nucleus of cells where it accumulates in nuclear speckles areas rich in splicing factors. Biologists often use immunofluorescence techniques and anti-SC antibodies to visualize and study SC35's localization and function within cells.
Biological function summary

SC35 influences various aspects of mRNA processing particularly pre-mRNA splicing. The protein functions as a splicing enhancer by interacting with pre-mRNA at specific sites to assist exon inclusion during splicing. SC35 acts as part of the spliceosomal complex which is critical during the assembly and rearrangement of the spliceosome. Additionally it interacts with other splicing factors to ensure accurate and efficient splicing which is fundamental for gene expression and consequent protein synthesis.

Pathways

The SC35 protein participates in the RNA splicing pathway a significant process in mRNA maturation and gene expression regulation. This protein interacts with other SR proteins like SRSF1 and components of the spliceosomal machinery. SC35's function is also important in the alternative splicing pathway impacting the diversity of mRNA transcripts through the production of different exon combinations. By regulating alternative splicing SC35 helps produce protein diversity vital for numerous cellular processes.

Changes in SC35 expression or function have been linked to several human conditions. Notably its dysregulation can contribute to cancer development through altered splicing patterns that impact oncogene and tumor suppressor gene expression. Furthermore SC35 abnormalities are associated with spinal muscular atrophy a neurodegenerative disorder where splicing regulation plays a significant role. In these diseases SC35 may interact with other proteins such as SMN (survival of motor neuron protein) and impact their functions highlighting its relevance in maintaining cellular health.

Specifications

Form

Liquid

General info

Function

Necessary for the splicing of pre-mRNA. It is required for formation of the earliest ATP-dependent splicing complex and interacts with spliceosomal components bound to both the 5'- and 3'-splice sites during spliceosome assembly. It also is required for ATP-dependent interactions of both U1 and U2 snRNPs with pre-mRNA. Interacts with other spliceosomal components, via the RS domains, to form a bridge between the 5'- and 3'-splice site binding components, U1 snRNP and U2AF. Binds to purine-rich RNA sequences, either 5'-AGSAGAGTA-3' (S=C or G) or 5'-GTTCGAGTA-3'. Can bind to beta-globin mRNA and commit it to the splicing pathway. The phosphorylated form (by SRPK2) is required for cellular apoptosis in response to cisplatin treatment.

Sequence similarities

Belongs to the splicing factor SR family.

Post-translational modifications

Extensively phosphorylated on serine residues in the RS domain. Phosphorylated by SRPK2 and this causes its redistribution from the nuclear speckle to nucleoplasm and controls cell fate decision in response to cisplatin treatment. KAT5/TIP60 inhibits its phosphorylation by preventing SRPK2 nuclear translocation.. Acetylation on Lys-52 by KAT5/TIP60 promotes its proteasomal degradation. This effect is counterbalanced by HDAC6, which positively controls SRSF2 protein level by deacetylating it and preventing its proteasomal degradation.

Subcellular localisation

Nucleus

Product protocols

Target data

Necessary for the splicing of pre-mRNA. It is required for formation of the earliest ATP-dependent splicing complex and interacts with spliceosomal components bound to both the 5'- and 3'-splice sites during spliceosome assembly. It also is required for ATP-dependent interactions of both U1 and U2 snRNPs with pre-mRNA. Interacts with other spliceosomal components, via the RS domains, to form a bridge between the 5'- and 3'-splice site binding components, U1 snRNP and U2AF. Binds to purine-rich RNA sequences, either 5'-AGSAGAGTA-3' (S=C or G) or 5'-GTTCGAGTA-3'. Can bind to beta-globin mRNA and commit it to the splicing pathway. The phosphorylated form (by SRPK2) is required for cellular apoptosis in response to cisplatin treatment.
See full target information SRSF2

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com