JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB316045

Recombinant Human SCF (Active) protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human SCF (Active) protein is a Human Fragment protein, in the 26 to 189 aa range, expressed in Escherichia coli, with >95%, < 1 EU/µg endotoxin level.

View Alternative Names

MGF, SCF, KITLG, Kit ligand, Mast cell growth factor, Stem cell factor, c-Kit ligand

Key facts

Purity

>95% HPLC

Endotoxin level

< 1 EU/µg

Expression system

Escherichia coli

Tags

Tag free

Biologically active

Yes

Biological activity

Measured in a cell proliferation assay using Mo7e cells. The ED50-for this effect is 1-8 ng/mL.

Accession

P21583

Animal free

No

Carrier free

No

Species

Human

Reconstitution

Centrifuge the tube before opening. Reconstituting to a concentration more than 100 ug/ml is recommended. Dissolve the lyophilized protein in distilled water.

Storage buffer

Constituents: PBS, 8% Trehalose

storage-buffer

Sequence info

[{"sequence":"EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA","proteinLength":"Fragment","predictedMolecularWeight":"18.45 kDa","actualMolecularWeight":null,"aminoAcidEnd":189,"aminoAcidStart":26,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P21583","tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage duration
A few days
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C|-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Stem Cell Factor (SCF) also known as kit ligand c-kit ligand or KITLG is a critical protein involved in cell signaling. It usually appears as a 30 kDa glycoprotein. SCF is widely expressed in various tissues including the bone marrow brain and fetal liver. Its major mechanical function is to bind to the c-KIT receptor triggering various intracellular pathways that influence cell proliferation survival and differentiation. Aside from its other names SCF in mouse plasma is often monitored including in assays like c-kit ligand ELISA.
Biological function summary

SCF acts as an indispensable growth factor promoting hematopoiesis and melanogenesis. It plays a significant role in the regulation of hematopoietic stem cells and mast cells. SCF and its receptor c-KIT form a complex that activates signaling pathways essential for these processes. This protein is also involved in gametogenesis by aiding the proliferation and survival of primordial germ cells. SCF's action is not limited to mammals as studies demonstrate its activity in other species like mouse SCF.

Pathways

SCF impacts multiple important biological systems by engaging with c-KIT. The SCF/c-KIT interaction contributes to the MAPK/ERK pathway influencing cell division and growth. It also plays a role in the PI3K/AKT pathway that governs cell survival. Beyond its direct association with c-KIT SCF's involvement in these pathways connects it to several other proteins like RAS and PI3K which are important for signal transduction.

SCF has associations with several pathological conditions. Dysregulation of the SCF/c-KIT pathway can lead to disorders like mastocytosis and certain leukemias. The overactivation or mutations in c-KIT are often implicated in these diseases due to its cooperative action with SCF. Additionally aberrant SCF signaling can contribute to the progression of gastrointestinal stromal tumors (GIST) where c-KIT has known relevance. Understanding SCF's role can therefore provide insights into diagnostic and therapeutic strategies for these conditions.

Specifications

Form

Lyophilized

General info

Function

Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. Promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5. KITLG/SCF and KIT promote activation of PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. KITLG/SCF acts synergistically with other cytokines, probably interleukins.

Sequence similarities

Belongs to the SCF family.

Post-translational modifications

A soluble form (sKITLG) is produced by proteolytic processing of isoform 1 in the extracellular domain.. Found in two differentially glycosylated forms, LMW-SCF and HMW-SCF. LMW-SCF is fully N-glycosylated at Asn-145, partially N-glycosylated at Asn-90, O-glycosylated at Ser-167, Thr-168 and Thr-180, and not glycosylated at Asn-97 or Asn-118. HMW-SCF is N-glycosylated at Asn-118, Asn-90 and Asn-145, O-glycosylated at Ser-167, Thr-168 and Thr-180, and not glycosylated at Asn-97.. A soluble form exists as a cleavage product of the extracellular domain.

Subcellular localisation

Cytoskeleton

Product protocols

Target data

Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. Promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5. KITLG/SCF and KIT promote activation of PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. KITLG/SCF acts synergistically with other cytokines, probably interleukins.
See full target information KITLG

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com