JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB259391

Recombinant human SCF protein (Active)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human SCF protein (Active) is a Human Fragment protein, in the 26 to 190 aa range, expressed in HEK 293 cells, with >95%, <0.005 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS, Mass Spec, Cell Culture, HPLC.

View Alternative Names

MGF, SCF, KITLG, Kit ligand, Mast cell growth factor, Stem cell factor, c-Kit ligand

4 Images
Mass Spectrometry - Recombinant human SCF protein (Active) (AB259391)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant human SCF protein (Active) (AB259391)

M + 0. 9 Da (calc mass 18586.85)

The spectrum was recorded with a 6545XT AdvanceBio LC/Q-TOF (Agilent Technologies) and a MabPac RP column (42.1x50 mm, 4 μm, Thermo Scientific). 5 μL of purified protein was injected and the gradient run from 85 % water : FA (99.9 : 0.1 v/v) and 15 % acetonitrile : FA (90 : 9.9 : 0.1 v/v/v) to 55 % water : FA (99.9 : 0.1 v/v) and 45 % acetonitrile : FA (90 : 9.9 : 0.1 v/v/v) within 3 minutes followed by an isocratic step for another 2.5 min. Flow rate was 0.4 mL/min and the column compartment temperature was 60 °C. Data was analysed and deconvoluted using the Bioconfirm software (Agilent Technologies).

Functional Studies - Recombinant human SCF protein (Active) (AB259391)
  • FuncS

Lab

Functional Studies - Recombinant human SCF protein (Active) (AB259391)

Fully biologically active when compared to standard. Determined by dose-dependant stimulation of human TF-1 cells. ED50 is ≤ 0.9601 ng /ml, corresponding to a specific activity of 1.04 x 106 units/mg.

SDS-PAGE - Recombinant human SCF protein (Active) (AB259391)
  • SDS-PAGE

Lab

SDS-PAGE - Recombinant human SCF protein (Active) (AB259391)

SDS-PAGE analysis of ab259391.

HPLC - Recombinant human SCF protein (Active) (AB259391)
  • HPLC

Lab

HPLC - Recombinant human SCF protein (Active) (AB259391)

Purity : 95%

The spectrum was recorded using a 1260 Infinity II HPLC system with DAD and a MabPac RP column (3.0x100 mm, 4 μm). 5 μL of purified protein was injected and the gradient run from 80 % water : TFA (99.9 : 0.1 v/v) and 20 % acetonitrile : water : TFA (90 : 9.9 : 0.1 v/v/v) to 20 % water : TFA (99.9 : 0.1 v/v) and 80 % acetonitrile : water : TFA (90 : 9.9 : 0.1 v/v/v) within 3 minutes followed by an isocratic step for another 3 min. Flow rate was 0.5 mL/min and the column compartment temperature was 50 °C.

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

<0.005 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

Mass Spec, Cell Culture, SDS-PAGE, HPLC, FuncS

applications

Biologically active

Yes

Biological activity

Fully biologically active when compared to standard. ED50 is ≤ 0.9601 ng /ml, corresponding to a specific activity of 1.04x 106 units/mg.

Accession

P21583

Animal free

No

Carrier free

No

Species

Human

Reconstitution

Reconstitute in PBS

Storage buffer

pH: 6 - 8 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Cell Culture": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This protein is filter sterilised prior to aliquoting and lyophilisation. All aliquoting and lyophilisation steps are performed in a sterile environment

Sequence info

[{"sequence":"EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVAA","proteinLength":"Fragment","predictedMolecularWeight":"18.59 kDa","actualMolecularWeight":null,"aminoAcidEnd":190,"aminoAcidStart":26,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P21583","tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
Ambient
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Stem Cell Factor (SCF) also known as kit ligand c-kit ligand or KITLG is a critical protein involved in cell signaling. It usually appears as a 30 kDa glycoprotein. SCF is widely expressed in various tissues including the bone marrow brain and fetal liver. Its major mechanical function is to bind to the c-KIT receptor triggering various intracellular pathways that influence cell proliferation survival and differentiation. Aside from its other names SCF in mouse plasma is often monitored including in assays like c-kit ligand ELISA.
Biological function summary

SCF acts as an indispensable growth factor promoting hematopoiesis and melanogenesis. It plays a significant role in the regulation of hematopoietic stem cells and mast cells. SCF and its receptor c-KIT form a complex that activates signaling pathways essential for these processes. This protein is also involved in gametogenesis by aiding the proliferation and survival of primordial germ cells. SCF's action is not limited to mammals as studies demonstrate its activity in other species like mouse SCF.

Pathways

SCF impacts multiple important biological systems by engaging with c-KIT. The SCF/c-KIT interaction contributes to the MAPK/ERK pathway influencing cell division and growth. It also plays a role in the PI3K/AKT pathway that governs cell survival. Beyond its direct association with c-KIT SCF's involvement in these pathways connects it to several other proteins like RAS and PI3K which are important for signal transduction.

SCF has associations with several pathological conditions. Dysregulation of the SCF/c-KIT pathway can lead to disorders like mastocytosis and certain leukemias. The overactivation or mutations in c-KIT are often implicated in these diseases due to its cooperative action with SCF. Additionally aberrant SCF signaling can contribute to the progression of gastrointestinal stromal tumors (GIST) where c-KIT has known relevance. Understanding SCF's role can therefore provide insights into diagnostic and therapeutic strategies for these conditions.

Specifications

Form

Lyophilized

Additional notes

Purity by HPLC >= 95%.

General info

Function

Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. Promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5. KITLG/SCF and KIT promote activation of PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. KITLG/SCF acts synergistically with other cytokines, probably interleukins.

Sequence similarities

Belongs to the SCF family.

Post-translational modifications

A soluble form (sKITLG) is produced by proteolytic processing of isoform 1 in the extracellular domain.. Found in two differentially glycosylated forms, LMW-SCF and HMW-SCF. LMW-SCF is fully N-glycosylated at Asn-145, partially N-glycosylated at Asn-90, O-glycosylated at Ser-167, Thr-168 and Thr-180, and not glycosylated at Asn-97 or Asn-118. HMW-SCF is N-glycosylated at Asn-118, Asn-90 and Asn-145, O-glycosylated at Ser-167, Thr-168 and Thr-180, and not glycosylated at Asn-97.. A soluble form exists as a cleavage product of the extracellular domain.

Subcellular localisation

Cytoskeleton

Product protocols

Target data

Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. Promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5. KITLG/SCF and KIT promote activation of PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. KITLG/SCF acts synergistically with other cytokines, probably interleukins.
See full target information KITLG

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com