JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB216259

Recombinant Human SDF1 alpha protein (Fc Chimera)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human SDF1 alpha protein (Fc Chimera) is a Human Fragment protein, in the 22 to 89 aa range, expressed in HEK 293 cells, with >95%, < 0.06 EU/µg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

SDF1, SDF1A, SDF1B, CXCL12, Stromal cell-derived factor 1, SDF-1, hSDF-1, C-X-C motif chemokine 12, Intercrine reduced in hepatomas, Pre-B cell growth-stimulating factor, IRH, hIRH, PBSF

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 0.06 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P48061

Animal free

No

Carrier free

No

Species

Human

Reconstitution

Reconstitute in water

Storage buffer

Constituents: PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"linker":null,"sequence":"KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK","proteinLength":"Fragment","predictedMolecularWeight":"35 kDa","actualMolecularWeight":null,"aminoAcidEnd":89,"aminoAcidStart":22,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P48061","tags":[]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

SDF1 alpha also known as CXCL12 is a chemokine with a molecular mass of approximately 8 kDa. It plays a significant role in the immune system by directing the movement of cells through chemotaxis. This protein is predominantly expressed in various tissues including bone marrow lymph nodes and lungs. Its expression occurs across different cell types such as endothelial cells fibroblasts and stromal cells making it an essential component of the cell signaling environment.
Biological function summary

SDF1 alpha participates in regulating the movement and positioning of hematopoietic stem cells supporting tissue homeostasis and repair. It operates often by binding to the G-protein coupled receptor CXCR4. This interaction is especially important in hematopoiesis vasculogenesis and neuron guidance. Although SDF1 alpha does not function as part of a larger complex its interaction with CXCR4 plays an important role for processes like development and wound healing.

Pathways

SDF1 alpha is heavily involved in the chemokine signaling pathway which is pivotal for immune responses and cellular communication. Its interaction with CXCR4 also links it to the MAPK/ERK pathway contributing to cell proliferation differentiation and survival. These pathways highlight the essential interplay between SDF1 alpha and proteins such as CXCR4 and CCR7 which are part of broader cellular responses.

SDF1 alpha has notable implications in cancer and HIV. Its interaction with CXCR4 is important in tumor growth and metastasis influencing the tumor microenvironment. For HIV SDF1 alpha and its receptor CXCR4 are critical in viral entry into host cells. A deeper understanding of these relationships can aid in identifying therapeutic targets and diagnosing these conditions effectively.

Specifications

Form

Lyophilized

General info

Function

Chemoattractant active on T-lymphocytes and monocytes but not neutrophils (PubMed : 18802065, PubMed : 39093700). Activates the C-X-C chemokine receptor CXCR4 to induce a rapid and transient rise in the level of intracellular calcium ions and chemotaxis (PubMed : 8752281, PubMed : 18802065, PubMed : 39093700). Also binds to atypical chemokine receptor ACKR3, which activates the beta-arrestin pathway and acts as a scavenger receptor for CXCL12/SDF-1 (PubMed : 16107333, PubMed : 19255243). Binds to the allosteric site (site 2) of integrins and activates integrins ITGAV : ITGB3, ITGA4 : ITGB1 and ITGA5 : ITGB1 in a CXCR4-independent manner (PubMed : 29301984). Acts as a positive regulator of monocyte migration and a negative regulator of monocyte adhesion via the LYN kinase (PubMed : 18802065). Stimulates migration of monocytes and T-lymphocytes through its receptors, CXCR4 and ACKR3, and decreases monocyte adherence to surfaces coated with ICAM-1, a ligand for beta-2 integrins (PubMed : 16107333, PubMed : 18802065, PubMed : 19255243, PubMed : 39093700). CXCR4 signaling axis inhibits beta-2 integrin LFA-1 mediated adhesion of monocytes to ICAM-1 through LYN kinase (PubMed : 18802065). Inhibits CXCR4-mediated infection by T-cell line-adapted HIV-1 (PubMed : 8752281). Plays a protective role after myocardial infarction. Induces down-regulation and internalization of ACKR3 expressed in various cells. Has several critical functions during embryonic development; required for B-cell lymphopoiesis, myelopoiesis in bone marrow and heart ventricular septum formation (By similarity). Stimulates the proliferation of bone marrow-derived B-cell progenitors in the presence of IL7 as well as growth of stromal cell-dependent pre-B-cells (By similarity).. SDF-1-beta(3-72). Shows a reduced chemotactic activity.. SDF-1-alpha(3-67). Shows a reduced chemotactic activity (PubMed : 14525775). Binding to cell surface proteoglycans seems to inhibit formation of SDF-1-alpha(3-67) and thus to preserve activity on local sites (PubMed : 14525775).

Sequence similarities

Belongs to the intercrine alpha (chemokine CxC) family.

Post-translational modifications

Processed forms SDF-1-beta(3-72) and SDF-1-alpha(3-67) are produced after secretion by proteolytic cleavage of isoforms Beta and Alpha, respectively. The N-terminal processing is probably achieved by DPP4. Isoform Alpha is first cleaved at the C-terminus to yield a SDF-1-alpha(1-67) intermediate before being processed at the N-terminus. The C-terminal processing of isoform Alpha is reduced by binding to heparin and, probably, cell surface proteoglycans.

Product protocols

Target data

Chemoattractant active on T-lymphocytes and monocytes but not neutrophils (PubMed : 18802065, PubMed : 39093700). Activates the C-X-C chemokine receptor CXCR4 to induce a rapid and transient rise in the level of intracellular calcium ions and chemotaxis (PubMed : 8752281, PubMed : 18802065, PubMed : 39093700). Also binds to atypical chemokine receptor ACKR3, which activates the beta-arrestin pathway and acts as a scavenger receptor for CXCL12/SDF-1 (PubMed : 16107333, PubMed : 19255243). Binds to the allosteric site (site 2) of integrins and activates integrins ITGAV : ITGB3, ITGA4 : ITGB1 and ITGA5 : ITGB1 in a CXCR4-independent manner (PubMed : 29301984). Acts as a positive regulator of monocyte migration and a negative regulator of monocyte adhesion via the LYN kinase (PubMed : 18802065). Stimulates migration of monocytes and T-lymphocytes through its receptors, CXCR4 and ACKR3, and decreases monocyte adherence to surfaces coated with ICAM-1, a ligand for beta-2 integrins (PubMed : 16107333, PubMed : 18802065, PubMed : 19255243, PubMed : 39093700). CXCR4 signaling axis inhibits beta-2 integrin LFA-1 mediated adhesion of monocytes to ICAM-1 through LYN kinase (PubMed : 18802065). Inhibits CXCR4-mediated infection by T-cell line-adapted HIV-1 (PubMed : 8752281). Plays a protective role after myocardial infarction. Induces down-regulation and internalization of ACKR3 expressed in various cells. Has several critical functions during embryonic development; required for B-cell lymphopoiesis, myelopoiesis in bone marrow and heart ventricular septum formation (By similarity). Stimulates the proliferation of bone marrow-derived B-cell progenitors in the presence of IL7 as well as growth of stromal cell-dependent pre-B-cells (By similarity).. SDF-1-beta(3-72). Shows a reduced chemotactic activity.. SDF-1-alpha(3-67). Shows a reduced chemotactic activity (PubMed : 14525775). Binding to cell surface proteoglycans seems to inhibit formation of SDF-1-alpha(3-67) and thus to preserve activity on local sites (PubMed : 14525775).
See full target information CXCL12

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com