JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB259416

Recombinant human SDF1 protein (Active)

Be the first to review this product! Submit a review

|

(2 Publications)

Recombinant human SDF1 protein (Active) is a Human Fragment protein, in the 22 to 89 aa range, expressed in HEK 293 cells, with >95%, <0.005 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS, Mass Spec, Cell Culture, HPLC.

View Alternative Names

SDF1, SDF1A, SDF1B, CXCL12, Stromal cell-derived factor 1, SDF-1, hSDF-1, C-X-C motif chemokine 12, Intercrine reduced in hepatomas, Pre-B cell growth-stimulating factor, IRH, hIRH, PBSF

4 Images
Mass Spectrometry - Recombinant human SDF1 protein (Active) (AB259416)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant human SDF1 protein (Active) (AB259416)

(M-Lys) +/- 0.1 Da (C-terminal Lys loss; calc. mass 7892 Da)

The spectrum was recorded with a 6545XT AdvanceBio LC/Q-TOF (Agilent Technologies) and a MabPac RP column (42.1x50 mm, 4 μm, Thermo Scientific). 5 μL of purified protein was injected and the gradient run from 85 % water : FA (99.9 : 0.1 v/v) and 15 % acetonitrile : FA (90 : 9.9 : 0.1 v/v/v) to 55 % water : FA (99.9 : 0.1 v/v) and 45 % acetonitrile : FA (90 : 9.9 : 0.1 v/v/v) within 3 minutes followed by an isocratic step for another 2.5 min. Flow rate was 0.4 mL/min and the column compartment temperature was 60 °C. Data was analysed and deconvoluted using the Bioconfirm software (Agilent Technologies).

Functional Studies - Recombinant human SDF1 protein (Active) (AB259416)
  • FuncS

AbReview

Functional Studies - Recombinant human SDF1 protein (Active) (AB259416)

Fully biologically active determined by the dose dependant migration of THP-1 cells.

ED50 is ≤ 40 ng/mL, corresponding to a specific activity of 2.50 x 104 units/mg.

HPLC - Recombinant human SDF1 protein (Active) (AB259416)
  • HPLC

Supplier Data

HPLC - Recombinant human SDF1 protein (Active) (AB259416)

Purity : 98.5%

The spectrum was recorded using a 1260 Infinity II HPLC system with DAD and a MabPac RP column (3.0x100 mm, 4 μm). 5 μL of purified protein was injected and the gradient run from 80 % water : TFA (99.9 : 0.1 v/v) and 20 % acetonitrile : water : TFA (90 : 9.9 : 0.1 v/v/v) to 20 % water : TFA (99.9 : 0.1 v/v) and 80 % acetonitrile : water : TFA (90 : 9.9 : 0.1 v/v/v) within 3 minutes followed by an isocratic step for another 3 min. Flow rate was 0.5 mL/min and the column compartment temperature was 50 °C.

SDS-PAGE - Recombinant human SDF1 protein (Active) (AB259416)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human SDF1 protein (Active) (AB259416)

SDS-PAGE analysis of ab259416.

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

<0.005 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

SDS-PAGE, FuncS, HPLC, Cell Culture, Mass Spec

applications

Biologically active

Yes

Biological activity

Fully biologically active determined by the dose dependant migration of THP-1 cells.

ED50 is ≤ 40 ng/mL, corresponding to a specific activity of 2.50 x 104 units/mg.

Accession

P48061

Animal free

Yes

Carrier free

No

Species

Human

Reconstitution

Reconstitute in PBS

Storage buffer

pH: 6 - 8 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Cell Culture": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This protein is filter sterilised prior to aliquoting and lyophilisation. All aliquoting and lyophilisation steps are performed in a sterile environment.

This protein could lose the C-terminal Lys, but this does not affect performance.

Sequence info

[{"sequence":"KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK","proteinLength":"Fragment","predictedMolecularWeight":"8.02 kDa","actualMolecularWeight":null,"aminoAcidEnd":89,"aminoAcidStart":22,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"P48061","tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
Ambient
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The stromal cell-derived factor 1 (SDF1) also known as C-X-C motif chemokine 12 (CXCL12) is a chemokine protein that is important in immunological responses and cellular signaling. This protein weighs approximately 8 kDa. SDF1 is largely expressed in bone marrow stroma liver and endothelium of various tissues positioning it as an integral player in cell migration and homing processes. The protein functions as a chemoattractant for lymphocytes promoting cellular trafficking and organ development.
Biological function summary

SDF1 influences the migration and survival of hematopoietic progenitor cells. It plays a pivotal role in heart development angiogenesis and neuronal protein regulation. SDF1 binds with high affinity to its receptor CXCR4 forming a critical signal transduction complex that modulates cellular movement and growth responses. This interaction is important in the regulation of cell positioning and potential pathways of pathological changes.

Pathways

SDF1 has an important role in the chemokine signaling pathway and is involved in the pathways controlling hematopoietic stem cell migration and homing. The interaction between SDF1 and CXCR4 triggers downstream signaling events engaging proteins like PI3K and MAPK which promote cell survival and proliferation. Furthermore the SDF1/CXCR4 axis is central to the vascular endothelial growth factor (VEGF) pathway facilitating angiogenesis and tissue repair mechanisms.

SDF1 relates closely to cancer metastasis and HIV infection. The SDF1/CXCR4 interaction acts as a co-receptor for HIV entry into host cells implicating it in viral pathogenesis. Overexpression of SDF1 and its binding partner CXCR4 contributes to tumor growth invasion and metastasis in various cancers by promoting angiogenesis and tumor cell migration. The targeting of the SDF1/CXCR4 axis holds therapeutic potential in cancer treatment and infectious disease management.

Specifications

Form

Lyophilized

Additional notes

>= 95 % HPLC.

General info

Function

Chemoattractant active on T-lymphocytes and monocytes but not neutrophils. Activates the C-X-C chemokine receptor CXCR4 to induce a rapid and transient rise in the level of intracellular calcium ions and chemotaxis. SDF-1-beta(3-72) and SDF-1-alpha(3-67) show a reduced chemotactic activity. Binding to cell surface proteoglycans seems to inhibit formation of SDF-1-alpha(3-67) and thus to preserve activity on local sites. Also binds to atypical chemokine receptor ACKR3, which activates the beta-arrestin pathway and acts as a scavenger receptor for SDF-1. Binds to the allosteric site (site 2) of integrins and activates integrins ITGAV : ITGB3, ITGA4 : ITGB1 and ITGA5 : ITGB1 in a CXCR4-independent manner (PubMed : 29301984). Acts as a positive regulator of monocyte migration and a negative regulator of monocyte adhesion via the LYN kinase. Stimulates migration of monocytes and T-lymphocytes through its receptors, CXCR4 and ACKR3, and decreases monocyte adherence to surfaces coated with ICAM-1, a ligand for beta-2 integrins. SDF1A/CXCR4 signaling axis inhibits beta-2 integrin LFA-1 mediated adhesion of monocytes to ICAM-1 through LYN kinase. Inhibits CXCR4-mediated infection by T-cell line-adapted HIV-1. Plays a protective role after myocardial infarction. Induces down-regulation and internalization of ACKR3 expressed in various cells. Has several critical functions during embryonic development; required for B-cell lymphopoiesis, myelopoiesis in bone marrow and heart ventricular septum formation. Stimulates the proliferation of bone marrow-derived B-cell progenitors in the presence of IL7 as well as growth of stromal cell-dependent pre-B-cells (By similarity).

Sequence similarities

Belongs to the intercrine alpha (chemokine CxC) family.

Post-translational modifications

Processed forms SDF-1-beta(3-72) and SDF-1-alpha(3-67) are produced after secretion by proteolytic cleavage of isoforms Beta and Alpha, respectively. The N-terminal processing is probably achieved by DPP4. Isoform Alpha is first cleaved at the C-terminus to yield a SDF-1-alpha(1-67) intermediate before being processed at the N-terminus. The C-terminal processing of isoform Alpha is reduced by binding to heparin and, probably, cell surface proteoglycans.

Product protocols

Target data

Chemoattractant active on T-lymphocytes and monocytes but not neutrophils. Activates the C-X-C chemokine receptor CXCR4 to induce a rapid and transient rise in the level of intracellular calcium ions and chemotaxis. SDF-1-beta(3-72) and SDF-1-alpha(3-67) show a reduced chemotactic activity. Binding to cell surface proteoglycans seems to inhibit formation of SDF-1-alpha(3-67) and thus to preserve activity on local sites. Also binds to atypical chemokine receptor ACKR3, which activates the beta-arrestin pathway and acts as a scavenger receptor for SDF-1. Binds to the allosteric site (site 2) of integrins and activates integrins ITGAV : ITGB3, ITGA4 : ITGB1 and ITGA5 : ITGB1 in a CXCR4-independent manner (PubMed : 29301984). Acts as a positive regulator of monocyte migration and a negative regulator of monocyte adhesion via the LYN kinase. Stimulates migration of monocytes and T-lymphocytes through its receptors, CXCR4 and ACKR3, and decreases monocyte adherence to surfaces coated with ICAM-1, a ligand for beta-2 integrins. SDF1A/CXCR4 signaling axis inhibits beta-2 integrin LFA-1 mediated adhesion of monocytes to ICAM-1 through LYN kinase. Inhibits CXCR4-mediated infection by T-cell line-adapted HIV-1. Plays a protective role after myocardial infarction. Induces down-regulation and internalization of ACKR3 expressed in various cells. Has several critical functions during embryonic development; required for B-cell lymphopoiesis, myelopoiesis in bone marrow and heart ventricular septum formation. Stimulates the proliferation of bone marrow-derived B-cell progenitors in the presence of IL7 as well as growth of stromal cell-dependent pre-B-cells (By similarity).
See full target information CXCL12

Publications (2)

Recent publications for all applications. Explore the full list and refine your search

PloS one 18:e0288281 PubMed37616250

2023

Human embryonic stem cells secrete macrophage migration inhibitory factor: A novel finding.

Applications

Unspecified application

Species

Unspecified reactive species

Yanzhao Wei,Xiaohan Zheng,Ting Huang,Yuanji Zhong,Shengtong Sun,Xufang Wei,Qibing Liu,Tan Wang,Zhenqiang Zhao

International journal of molecular medicine 47: PubMed33649808

2021

MTSS1 inhibits colorectal cancer metastasis by regulating the CXCR4/CXCL12 signaling axis.

Applications

Unspecified application

Species

Unspecified reactive species

Lei Chen,Qiang Chen,Yongyou Wu,Minggao Zhu,Jia Hu,Zhixiang Zhuang
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com