JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB9798

Recombinant human SDF1 protein (Active)

Be the first to review this product! Submit a review

|

(7 Publications)

Recombinant human SDF1 protein (Active) is a Human Full Length protein, in the 22 to 89 aa range, expressed in Escherichia coli, with >98%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS, HPLC.

View Alternative Names

SDF1, SDF1A, SDF1B, CXCL12, Stromal cell-derived factor 1, SDF-1, hSDF-1, C-X-C motif chemokine 12, Intercrine reduced in hepatomas, Pre-B cell growth-stimulating factor, IRH, hIRH, PBSF

Key facts

Purity

>98% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

Escherichia coli

Tags

Tag free

Applications

SDS-PAGE, FuncS, HPLC

applications

Biologically active

Yes

Biological activity

Determined by its ability to chemoattract human peripheral T cells activated with PHA and IL-2 using a concentation of 20-80 ng/ml.

Accession

P48061

Animal free

No

Carrier free

No

Species

Human

Reconstitution

Reconstitute at 0.1 mg/mL in water

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK","proteinLength":"Full Length","predictedMolecularWeight":"8 kDa","actualMolecularWeight":null,"aminoAcidEnd":89,"aminoAcidStart":22,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P48061","tags":[]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The stromal cell-derived factor 1 (SDF1) also known as C-X-C motif chemokine 12 (CXCL12) is a chemokine protein that is important in immunological responses and cellular signaling. This protein weighs approximately 8 kDa. SDF1 is largely expressed in bone marrow stroma liver and endothelium of various tissues positioning it as an integral player in cell migration and homing processes. The protein functions as a chemoattractant for lymphocytes promoting cellular trafficking and organ development.
Biological function summary

SDF1 influences the migration and survival of hematopoietic progenitor cells. It plays a pivotal role in heart development angiogenesis and neuronal protein regulation. SDF1 binds with high affinity to its receptor CXCR4 forming a critical signal transduction complex that modulates cellular movement and growth responses. This interaction is important in the regulation of cell positioning and potential pathways of pathological changes.

Pathways

SDF1 has an important role in the chemokine signaling pathway and is involved in the pathways controlling hematopoietic stem cell migration and homing. The interaction between SDF1 and CXCR4 triggers downstream signaling events engaging proteins like PI3K and MAPK which promote cell survival and proliferation. Furthermore the SDF1/CXCR4 axis is central to the vascular endothelial growth factor (VEGF) pathway facilitating angiogenesis and tissue repair mechanisms.

SDF1 relates closely to cancer metastasis and HIV infection. The SDF1/CXCR4 interaction acts as a co-receptor for HIV entry into host cells implicating it in viral pathogenesis. Overexpression of SDF1 and its binding partner CXCR4 contributes to tumor growth invasion and metastasis in various cancers by promoting angiogenesis and tumor cell migration. The targeting of the SDF1/CXCR4 axis holds therapeutic potential in cancer treatment and infectious disease management.

Specifications

Form

Lyophilized

Additional notes

>= HPLC analyses.Sterile filtered.

General info

Function

Chemoattractant active on T-lymphocytes and monocytes but not neutrophils (PubMed : 18802065, PubMed : 39093700). Activates the C-X-C chemokine receptor CXCR4 to induce a rapid and transient rise in the level of intracellular calcium ions and chemotaxis (PubMed : 8752281, PubMed : 18802065, PubMed : 39093700). Also binds to atypical chemokine receptor ACKR3, which activates the beta-arrestin pathway and acts as a scavenger receptor for CXCL12/SDF-1 (PubMed : 16107333, PubMed : 19255243). Binds to the allosteric site (site 2) of integrins and activates integrins ITGAV : ITGB3, ITGA4 : ITGB1 and ITGA5 : ITGB1 in a CXCR4-independent manner (PubMed : 29301984). Acts as a positive regulator of monocyte migration and a negative regulator of monocyte adhesion via the LYN kinase (PubMed : 18802065). Stimulates migration of monocytes and T-lymphocytes through its receptors, CXCR4 and ACKR3, and decreases monocyte adherence to surfaces coated with ICAM-1, a ligand for beta-2 integrins (PubMed : 16107333, PubMed : 18802065, PubMed : 19255243, PubMed : 39093700). CXCR4 signaling axis inhibits beta-2 integrin LFA-1 mediated adhesion of monocytes to ICAM-1 through LYN kinase (PubMed : 18802065). Inhibits CXCR4-mediated infection by T-cell line-adapted HIV-1 (PubMed : 8752281). Plays a protective role after myocardial infarction. Induces down-regulation and internalization of ACKR3 expressed in various cells. Has several critical functions during embryonic development; required for B-cell lymphopoiesis, myelopoiesis in bone marrow and heart ventricular septum formation (By similarity). Stimulates the proliferation of bone marrow-derived B-cell progenitors in the presence of IL7 as well as growth of stromal cell-dependent pre-B-cells (By similarity).. SDF-1-beta(3-72). Shows a reduced chemotactic activity.. SDF-1-alpha(3-67). Shows a reduced chemotactic activity (PubMed : 14525775). Binding to cell surface proteoglycans seems to inhibit formation of SDF-1-alpha(3-67) and thus to preserve activity on local sites (PubMed : 14525775).

Sequence similarities

Belongs to the intercrine alpha (chemokine CxC) family.

Post-translational modifications

Processed forms SDF-1-beta(3-72) and SDF-1-alpha(3-67) are produced after secretion by proteolytic cleavage of isoforms Beta and Alpha, respectively. The N-terminal processing is probably achieved by DPP4. Isoform Alpha is first cleaved at the C-terminus to yield a SDF-1-alpha(1-67) intermediate before being processed at the N-terminus. The C-terminal processing of isoform Alpha is reduced by binding to heparin and, probably, cell surface proteoglycans.

Product protocols

Target data

Chemoattractant active on T-lymphocytes and monocytes but not neutrophils (PubMed : 18802065, PubMed : 39093700). Activates the C-X-C chemokine receptor CXCR4 to induce a rapid and transient rise in the level of intracellular calcium ions and chemotaxis (PubMed : 8752281, PubMed : 18802065, PubMed : 39093700). Also binds to atypical chemokine receptor ACKR3, which activates the beta-arrestin pathway and acts as a scavenger receptor for CXCL12/SDF-1 (PubMed : 16107333, PubMed : 19255243). Binds to the allosteric site (site 2) of integrins and activates integrins ITGAV : ITGB3, ITGA4 : ITGB1 and ITGA5 : ITGB1 in a CXCR4-independent manner (PubMed : 29301984). Acts as a positive regulator of monocyte migration and a negative regulator of monocyte adhesion via the LYN kinase (PubMed : 18802065). Stimulates migration of monocytes and T-lymphocytes through its receptors, CXCR4 and ACKR3, and decreases monocyte adherence to surfaces coated with ICAM-1, a ligand for beta-2 integrins (PubMed : 16107333, PubMed : 18802065, PubMed : 19255243, PubMed : 39093700). CXCR4 signaling axis inhibits beta-2 integrin LFA-1 mediated adhesion of monocytes to ICAM-1 through LYN kinase (PubMed : 18802065). Inhibits CXCR4-mediated infection by T-cell line-adapted HIV-1 (PubMed : 8752281). Plays a protective role after myocardial infarction. Induces down-regulation and internalization of ACKR3 expressed in various cells. Has several critical functions during embryonic development; required for B-cell lymphopoiesis, myelopoiesis in bone marrow and heart ventricular septum formation (By similarity). Stimulates the proliferation of bone marrow-derived B-cell progenitors in the presence of IL7 as well as growth of stromal cell-dependent pre-B-cells (By similarity).. SDF-1-beta(3-72). Shows a reduced chemotactic activity.. SDF-1-alpha(3-67). Shows a reduced chemotactic activity (PubMed : 14525775). Binding to cell surface proteoglycans seems to inhibit formation of SDF-1-alpha(3-67) and thus to preserve activity on local sites (PubMed : 14525775).
See full target information CXCL12

Publications (7)

Recent publications for all applications. Explore the full list and refine your search

Cell communication and signaling : CCS 21:36 PubMed36788616

2023

Mesenchymal stromal cell-associated migrasomes: a new source of chemoattractant for cells of hematopoietic origin.

Applications

Unspecified application

Species

Unspecified reactive species

Ilker A Deniz,Jana Karbanová,Manja Wobus,Martin Bornhäuser,Pauline Wimberger,Jan Dominik Kuhlmann,Denis Corbeil

Antioxidants (Basel, Switzerland) 12: PubMed36670936

2022

Specificity Protein 1-Mediated Promotion of CXCL12 Advances Endothelial Cell Metabolism and Proliferation in Pulmonary Hypertension.

Applications

Unspecified application

Species

Unspecified reactive species

Evan R DeVallance,Christopher M Dustin,Daniel Simoes de Jesus,Imad Al Ghouleh,John C Sembrat,Eugenia Cifuentes-Pagano,Patrick J Pagano

Cancers 14: PubMed35158871

2022

Decoding Single Cell Morphology in Osteotropic Breast Cancer Cells for Dissecting Their Migratory, Molecular and Biophysical Heterogeneity.

Applications

Unspecified application

Species

Unspecified reactive species

Lila Bemmerlein,Ilker A Deniz,Jana Karbanová,Angela Jacobi,Stephan Drukewitz,Theresa Link,Andy Göbel,Lisa Sevenich,Anna V Taubenberger,Pauline Wimberger,Jan Dominik Kuhlmann,Denis Corbeil

Frontiers in oncology 10:994 PubMed32719743

2020

Insulin-Like Growth Factor 2 mRNA-Binding Protein 3 Modulates Aggressiveness of Ewing Sarcoma by Regulating the CD164-CXCR4 Axis.

Applications

Unspecified application

Species

Unspecified reactive species

Caterina Mancarella,Giulia Caldoni,Irene Ribolsi,Alessandro Parra,Maria Cristina Manara,Arthur M Mercurio,Andrea Morrione,Katia Scotlandi

PloS one 15:e0232536 PubMed32353075

2020

Stromal cell-derived factor 1 regulates in vitro sperm migration towards the cumulus-oocyte complex in cattle.

Applications

Unspecified application

Species

Unspecified reactive species

Kohei Umezu,Kenshiro Hara,Yuuki Hiradate,Takashi Numabe,Kentaro Tanemura

International journal of molecular medicine 45:141-150 PubMed31746344

2019

Cordycepin suppresses the migration and invasion of human liver cancer cells by downregulating the expression of CXCR4.

Applications

Unspecified application

Species

Unspecified reactive species

Zhongrong Guo,Wen Chen,Guisen Dai,Yuanliang Huang

Molecular medicine reports 20:4831-4842 PubMed31661133

2019

CP-25 exerts anti-angiogenic effects on a rat model of adjuvant-induced arthritis by promoting GRK2-induced downregulation of CXCR4-ERK1/2 signaling in endothelial cells.

Applications

Unspecified application

Species

Unspecified reactive species

Min Zhang,Mei Gao,Jinyu Chen,Lihua Song,Wei Wei
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com