JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB226268

Recombinant Human SDHA protein (Tagged)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human SDHA protein (Tagged) is a Human Fragment protein, in the 44 to 293 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

SDH2, SDHF, SDHA, Flavoprotein subunit of complex II, Malate dehydrogenase [quinone] flavoprotein subunit, Fp

3 Images
Mass Spectrometry - Recombinant Human SDHA protein (Tagged) (AB226268)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Human SDHA protein (Tagged) (AB226268)

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS analysis result of ab226268 could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) SDHA.

Mass Spectrometry - Recombinant Human SDHA protein (Tagged) (AB226268)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Human SDHA protein (Tagged) (AB226268)

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS analysis result of ab226268 could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) SDHA.

SDS-PAGE - Recombinant Human SDHA protein (Tagged) (AB226268)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human SDHA protein (Tagged) (AB226268)

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab226268 with 5% enrichment gel and 15% separation gel.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

GST tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

P31040

Animal free

No

Carrier free

No

Species

Human

Storage buffer

Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"SAKVSDSISAQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPAAVVELENYGMPFSRTEDGKIYQRAFGGQSLKFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIEDGSIHRIRAKNTVVATGGYGRTYFSCTSAHTSTGDGTAMITRAGLPCQDLEFV","proteinLength":"Fragment","predictedMolecularWeight":"54.1 kDa","actualMolecularWeight":null,"aminoAcidEnd":293,"aminoAcidStart":44,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P31040","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Succinate dehydrogenase complex flavoprotein subunit A (SDHA) also known as complex II Fp or SDH2 plays an important role in the mitochondrial electron transport chain and the tricarboxylic acid (TCA) cycle. It functions as a flavoprotein oxidoreductase catalyzing the oxidation of succinate to fumarate. With a molecular mass of approximately 72 kDa SDHA is expressed in the inner mitochondrial membrane of eukaryotic cells where it is a core component of the succinate dehydrogenase complex (SDHC). The complex is essential for cellular respiration and energy production.
Biological function summary

SDHA participates in the TCA cycle by accepting electrons from succinate which it donates to the coenzyme Q in the electron transport chain. This essential role connects SDHA to the regulation of ATP production in cells. SDHA operates as part of the larger succinate dehydrogenase (SDH) complex which includes other subunits such as SDHB SDHC and SDHD. This structurally integrated multisubunit complex influences mitochondrial integrity and cellular energy homeostasis.

Pathways

SDHA is deeply involved in the TCA cycle and oxidative phosphorylation pathway. As a part of these pathways it links to other critical enzymes such as fumarase and aconitase working in concert to drive the conversion of biochemical fuel into usable cellular energy. Its interactions with coenzyme Q and cytochrome complex enzymes are important for electron flow and proton gradient formation across the mitochondrial membrane. Such interactions are central to cellular respiration and energy generation.

Mutations in SDHA correlate with various mitochondrial diseases and cancer syndromes. Specifically SDHA mutations have an association with Leigh syndrome and certain types of mitochondrial complex II deficiency. These mutations disrupt the function of the SDH complex causing metabolic imbalances and energy production issues. Furthermore the integral interaction of SDHA with other SDH subunits means that alterations can impact this entire enzymatic complex with implications for cellular respiration and disease progression.

Specifications

Form

Liquid

General info

Function

Flavoprotein (FP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q) (PubMed : 10746566, PubMed : 24781757). SDH also oxidizes malate to the non-canonical enol form of oxaloacetate, enol-oxaloacetate (By similarity). Enol-oxaloacetate, which is a potent inhibitor of the succinate dehydrogenase activity, is further isomerized into keto-oxaloacetate (By similarity). Can act as a tumor suppressor (PubMed : 20484225).

Sequence similarities

Belongs to the FAD-dependent oxidoreductase 2 family. FRD/SDH subfamily.

Post-translational modifications

Phosphorylation at Tyr-215 is important for efficient electron transfer in complex II and the prevention of ROS generation.. Acetylated. Deacetylated by SIRT3.

Product protocols

Target data

Flavoprotein (FP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q) (PubMed : 10746566, PubMed : 24781757). SDH also oxidizes malate to the non-canonical enol form of oxaloacetate, enol-oxaloacetate (By similarity). Enol-oxaloacetate, which is a potent inhibitor of the succinate dehydrogenase activity, is further isomerized into keto-oxaloacetate (By similarity). Can act as a tumor suppressor (PubMed : 20484225).
See full target information SDHA

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com