JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB105635

Recombinant Human SEC13L1 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human SEC13L1 protein is a Human Full Length protein, in the 1 to 322 aa range, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

D3S1231E, SEC13A, SEC13L1, SEC13R, SEC13, Protein SEC13 homolog, GATOR2 complex protein SEC13, SEC13-like protein 1, SEC13-related protein

1 Images
SDS-PAGE - Recombinant Human SEC13L1 protein (AB105635)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human SEC13L1 protein (AB105635)

3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain.

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

P55735

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 0.58% Sodium chloride, 0.316% Tris HCl, 0.0154% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASGGCDNLIKLWKEEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDVNKGQGSVSASVTEGQQNEQ","proteinLength":"Full Length","predictedMolecularWeight":"37.7 kDa","actualMolecularWeight":null,"aminoAcidEnd":322,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P55735","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

SEC13L1 also known as SEC13 or SEC13-like is a protein encoded by the SEC13L1 gene. It is a component of a complex involved in vesicle trafficking. The protein has an approximate molecular mass of 37 kDa and is known to be expressed in various tissues across the human body indicating a broad functional role. SEC13L1 is an integral part of the coated vesicles that mediate protein transportation between the endoplasmic reticulum and the Golgi apparatus.
Biological function summary

As a part of the SEC13 complex SEC13L1 serves an essential function in the process of vesicular transport. This protein forms a core element of the COPII coat complex which is a multi-protein assembly responsible for the budding of transport vesicles from the endoplasmic reticulum. Besides its role in protein transport SEC13L1 also participates in maintaining the architecture of the nuclear pore complex which is critical for nucleocytoplasmic transport.

Pathways

SEC13L1 plays an important role in the secretory pathway and is involved in the ER-Golgi transport pathway. It associates closely with proteins like SEC24 and SEC23 which work together in the COPII coat formation. The interaction with these proteins is important for the selection of cargo proteins that are exported in COPII vesicles. Furthermore SEC13L1 is also involved in the regulation of nucleocytoplasmic transport pathways alongside proteins such as NUP107 as part of the nuclear pore complex degradation.

SEC13L1 has been associated with nephrotic syndrome where its dysregulation may impact protein trafficking and cellular homeostasis. It also plays a role in cancer where the protein's involvement in nuclear pore functions and vesicle formation may affect cell proliferation and survival. SEC13L1 links to disorders involving nucleocytoplasmic transport often interacting with nucleoporins such as NUP133 that may be implicated in pathogenesis.

Specifications

Form

Liquid

Additional notes

Purified using conventional chromatography techniques.

General info

Function

Functions as a component of the nuclear pore complex (NPC) and the COPII coat (PubMed : 8972206). At the endoplasmic reticulum, SEC13 is involved in the biogenesis of COPII-coated vesicles (PubMed : 8972206). Required for the exit of adipsin (CFD/ADN), an adipocyte-secreted protein from the endoplasmic reticulum (By similarity).. As a component of the GATOR2 complex, functions as an activator of the amino acid-sensing branch of the mTORC1 signaling pathway (PubMed : 23723238, PubMed : 25457612, PubMed : 27487210, PubMed : 35831510, PubMed : 36528027). The GATOR2 complex indirectly activates mTORC1 through the inhibition of the GATOR1 subcomplex (PubMed : 23723238, PubMed : 27487210, PubMed : 35831510, PubMed : 36528027). GATOR2 probably acts as an E3 ubiquitin-protein ligase toward GATOR1 (PubMed : 36528027). In the presence of abundant amino acids, the GATOR2 complex mediates ubiquitination of the NPRL2 core component of the GATOR1 complex, leading to GATOR1 inactivation (PubMed : 36528027). In the absence of amino acids, GATOR2 is inhibited, activating the GATOR1 complex (PubMed : 25457612, PubMed : 26972053, PubMed : 27487210). Within the GATOR2 complex, SEC13 and SEH1L are required to stabilize the complex (PubMed : 35831510).

Sequence similarities

Belongs to the WD repeat SEC13 family.

Subcellular localisation

Nucleus

Product protocols

Target data

Functions as a component of the nuclear pore complex (NPC) and the COPII coat (PubMed : 8972206). At the endoplasmic reticulum, SEC13 is involved in the biogenesis of COPII-coated vesicles (PubMed : 8972206). Required for the exit of adipsin (CFD/ADN), an adipocyte-secreted protein from the endoplasmic reticulum (By similarity).. As a component of the GATOR2 complex, functions as an activator of the amino acid-sensing branch of the mTORC1 signaling pathway (PubMed : 23723238, PubMed : 25457612, PubMed : 27487210, PubMed : 35831510, PubMed : 36528027). The GATOR2 complex indirectly activates mTORC1 through the inhibition of the GATOR1 subcomplex (PubMed : 23723238, PubMed : 27487210, PubMed : 35831510, PubMed : 36528027). GATOR2 probably acts as an E3 ubiquitin-protein ligase toward GATOR1 (PubMed : 36528027). In the presence of abundant amino acids, the GATOR2 complex mediates ubiquitination of the NPRL2 core component of the GATOR1 complex, leading to GATOR1 inactivation (PubMed : 36528027). In the absence of amino acids, GATOR2 is inhibited, activating the GATOR1 complex (PubMed : 25457612, PubMed : 26972053, PubMed : 27487210). Within the GATOR2 complex, SEC13 and SEH1L are required to stabilize the complex (PubMed : 35831510).
See full target information SEC13

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com