JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB174411

Recombinant Human SEC61B protein - BSA and Azide free (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human SEC61B protein - BSA and Azide free (His tag N-Terminus) is a Human Fragment protein, in the 1 to 70 aa range, expressed in Escherichia coli, with >85%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

Protein transport protein Sec61 subunit beta, SEC61B

1 Images
SDS-PAGE - Recombinant Human SEC61B protein - BSA and Azide free (His tag N-Terminus) (AB174411)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human SEC61B protein - BSA and Azide free (His tag N-Terminus) (AB174411)

15% SDS-PAGE analysis of ab174411 (3 μg).

Key facts

Purity

>85% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

P60468

Animal free

No

Carrier free

Yes

Species

Human

Storage buffer

pH: 8 Constituents: 50% Glycerol (glycerin, glycerine), 1.17% Sodium chloride, 0.32% Tris HCl, 0.03% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSMPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLKVGP","proteinLength":"Fragment","predictedMolecularWeight":"9.4 kDa","actualMolecularWeight":null,"aminoAcidEnd":70,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P60468","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

SEC61B also known as Sec61 beta subunit or Protein Transport Protein Sec61 subunit beta is a component of the Sec61 complex. It has a mass of approximately 9 kDa. SEC61B is expressed broadly in various tissues but it is found most abundantly in the endoplasmic reticulum (ER) membrane. This protein functions mechanically as a part of the protein translocation machinery that guides nascent polypeptides into or across the ER membrane.
Biological function summary

SEC61B assists in the regulation and positioning of the Sec61 translocon complex which includes alpha and gamma subunits. This protein is not a gatekeeper of the channel but rather stabilizes the complex and influences co-translational and post-translational translocation of proteins. It plays roles in maintaining ER homeostasis and facilitating the integration of newly synthesized proteins into the ER membrane affecting various cellular processes such as secretion and membrane biogenesis.

Pathways

SEC61B operates in the protein translocation pathways within the ER membrane. It is integral to the secretory pathway that moves proteins from the cytoplasm into the ER lumen or membrane. Additionally SEC61B interacts with proteins like ribosome-bound signal recognition particle (SRP) to facilitate accurate protein targeting and translocation. It associates with other ER resident proteins to manage polypeptide folding and processing.

SEC61B has connections to conditions that involve protein misfolding and improperly handled ER stress such as cystic fibrosis and certain neurodegenerative diseases. In cystic fibrosis misfolded proteins can trigger ER stress and cause adaptive responses. The involvement of proteins like the SEC61 complex in ameliorating ER stress highlights potential therapeutic targets. Therefore understanding SEC61B function and regulation may provide insights into therapeutic intervention for ER-stress-related disorders.

Specifications

Form

Liquid

Additional notes

ab174411 was purified using conventional chromatography.

General info

Function

Component of SEC61 channel-forming translocon complex that mediates transport of signal peptide-containing precursor polypeptides across the endoplasmic reticulum (ER) (PubMed : 12475939). Forms a ribosome receptor and a gated pore in the ER membrane, both functions required for cotranslational translocation of nascent polypeptides (PubMed : 12475939). The SEC61 channel is also involved in ER membrane insertion of transmembrane proteins : it mediates membrane insertion of the first few transmembrane segments of proteins, while insertion of subsequent transmembrane regions of multi-pass membrane proteins is mediated by the multi-pass translocon (MPT) complex (PubMed : 32820719, PubMed : 36261522). The SEC61 channel cooperates with the translocating protein TRAM1 to import nascent proteins into the ER (PubMed : 19121997).

Sequence similarities

Belongs to the SEC61-beta family.

Product protocols

Target data

Component of SEC61 channel-forming translocon complex that mediates transport of signal peptide-containing precursor polypeptides across the endoplasmic reticulum (ER) (PubMed : 12475939). Forms a ribosome receptor and a gated pore in the ER membrane, both functions required for cotranslational translocation of nascent polypeptides (PubMed : 12475939). The SEC61 channel is also involved in ER membrane insertion of transmembrane proteins : it mediates membrane insertion of the first few transmembrane segments of proteins, while insertion of subsequent transmembrane regions of multi-pass membrane proteins is mediated by the multi-pass translocon (MPT) complex (PubMed : 32820719, PubMed : 36261522). The SEC61 channel cooperates with the translocating protein TRAM1 to import nascent proteins into the ER (PubMed : 19121997).
See full target information SEC61B

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com