JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB268953

Recombinant human SENP1 protein (Active)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human SENP1 protein (Active) is a Human Fragment protein, in the 409 to 644 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, FuncS.

View Alternative Names

Sentrin-specific protease 1, Sentrin/SUMO-specific protease SENP1, SENP1

2 Images
Functional Studies - Recombinant human SENP1 protein (Active) (AB268953)
  • FuncS

Supplier Data

Functional Studies - Recombinant human SENP1 protein (Active) (AB268953)

The specific activity of ab268953 was ≥3902 nmol/min/mg in a deubiquitinase assay using recombinant human SUMO1-based proluciferin protein as substrate.

SDS-PAGE - Recombinant human SENP1 protein (Active) (AB268953)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human SENP1 protein (Active) (AB268953)

SDS-PAGE analysis of ab268953.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

FuncS, SDS-PAGE

applications

Biologically active

Yes

Biological activity

The specific activity of ab268953 was ≥3902 nmol/min/mg in a deubiquitinase assay using recombinant human SUMO1-based proluciferin protein as substrate.

Accession

Q9P0U3

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7 Preservative: 1.02% Imidazole Constituents: 25% Glycerol (glycerin, glycerine), 1.74% Sodium chloride, 0.82% Sodium phosphate, 0.004% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 0.002% PMSF

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"KGHKLTDSEDEFPEITEEMEKEIKNVFRNGNQDEVLSEAFRLTITRKDIQTLNHLNWLNDEIINFYMNMLMERSKEKGLPSVHAFNTFFFTKLKTAGYQAVKRWTKKVDVFSVDILLVPIHLGVHWCLAVVDFRKKNITYYDSMGGINNEACRILLQYLKQESIDKKRKEFDTNGWQLFSKKSQEIPQQMNGSDCGMFACKYADCITKDRPINFTQQHMPYFRKRMVWEILHRKLL","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":644,"aminoAcidStart":409,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q9P0U3","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

SENP1 also known as SUMO-specific protease 1 is an enzyme involved in the process of sumoylation a post-translational modification mechanism affecting various proteins. This enzyme has an approximate molecular mass of 73 kDa. SENP1 specifically cleaves SUMO (Small Ubiquitin-like Modifier) from target proteins regulating their function and localization. It shows strong expression in tissues with high cellular turnover like the thymus spleen and testis indicating its significant role in cell growth and development processes.
Biological function summary

SENP1 contributes to cellular homeostasis by modifying and controlling protein interactions and functions. This enzyme facilitates the recycling of SUMO proteins and affects transcription factors such as HIF1α which are vital for cellular response to hypoxia. SENP1 interacts closely with SUMO E3 ligases in complexes coordinating the addition or removal of SUMO groups from target proteins. Its activity is essential for maintaining the balance between protein sumoylation and desumoylation which impacts numerous cellular processes including cell cycle progression and stress response.

Pathways

SENP1 modulates key regulatory pathways related to its sumoylation mechanism. Major pathways where SENP1 plays a role include the HIF-1 signaling pathway where it affects the stability and activity of HIF1α under low oxygen conditions and the p53 signaling pathway influencing cell cycle and apoptosis. SENP1's interactivity with proteins like Ubc9 a SUMO-conjugating enzyme and PIAS3 a SUMO E3 ligase indicates its broad involvement and regulation within these pathways emphasizing its impact on maintaining cellular function and adaptation.

SENP1 associates with certain cancers and neurodegenerative disorders due to its regulatory influence on protein stability and gene expression. Overexpression of SENP1 is often observed in prostate cancer where it desumoylates HIF1α enhancing its transcriptional activity and promoting tumorigenesis. Additionally alterations in SENP1 function might connect to neurodegenerative diseases like Alzheimer's where protein turnover and cellular stress responses are disrupted. Through these disorders SENP1 connects with proteins such as AR (androgen receptor) in cancer contexts and Tau in Alzheimer's underlying its role in disease pathology.

Specifications

Form

Liquid

General info

Function

Protease that catalyzes two essential functions in the SUMO pathway (PubMed : 10652325, PubMed : 15199155, PubMed : 15487983, PubMed : 16253240, PubMed : 16553580, PubMed : 21829689, PubMed : 21965678, PubMed : 23160374, PubMed : 24943844, PubMed : 25406032, PubMed : 29506078, PubMed : 34048572, PubMed : 37257451). The first is the hydrolysis of an alpha-linked peptide bond at the C-terminal end of the small ubiquitin-like modifier (SUMO) propeptides, SUMO1, SUMO2 and SUMO3 leading to the mature form of the proteins (PubMed : 15487983). The second is the deconjugation of SUMO1, SUMO2 and SUMO3 from targeted proteins, by cleaving an epsilon-linked peptide bond between the C-terminal glycine of the mature SUMO and the lysine epsilon-amino group of the target protein (PubMed : 15199155, PubMed : 16253240, PubMed : 21829689, PubMed : 21965678, PubMed : 23160374, PubMed : 24943844, PubMed : 25406032, PubMed : 29506078, PubMed : 34048572, PubMed : 37257451). Deconjugates SUMO1 from HIPK2 (PubMed : 16253240). Deconjugates SUMO1 from HDAC1 and BHLHE40/DEC1, which decreases its transcriptional repression activity (PubMed : 15199155, PubMed : 21829689). Deconjugates SUMO1 from CLOCK, which decreases its transcriptional activation activity (PubMed : 23160374). Deconjugates SUMO2 from MTA1 (PubMed : 21965678). Inhibits N(6)-methyladenosine (m6A) RNA methylation by mediating SUMO1 deconjugation from METTL3 and ALKBH5 : METTL3 inhibits the m6A RNA methyltransferase activity, while ALKBH5 desumoylation promotes m6A demethylation (PubMed : 29506078, PubMed : 34048572, PubMed : 37257451). Desumoylates CCAR2 which decreases its interaction with SIRT1 (PubMed : 25406032). Deconjugates SUMO1 from GPS2 (PubMed : 24943844).

Sequence similarities

Belongs to the peptidase C48 family.

Subcellular localisation

Nucleus

Product protocols

Target data

Protease that catalyzes two essential functions in the SUMO pathway (PubMed : 10652325, PubMed : 15199155, PubMed : 15487983, PubMed : 16253240, PubMed : 16553580, PubMed : 21829689, PubMed : 21965678, PubMed : 23160374, PubMed : 24943844, PubMed : 25406032, PubMed : 29506078, PubMed : 34048572, PubMed : 37257451). The first is the hydrolysis of an alpha-linked peptide bond at the C-terminal end of the small ubiquitin-like modifier (SUMO) propeptides, SUMO1, SUMO2 and SUMO3 leading to the mature form of the proteins (PubMed : 15487983). The second is the deconjugation of SUMO1, SUMO2 and SUMO3 from targeted proteins, by cleaving an epsilon-linked peptide bond between the C-terminal glycine of the mature SUMO and the lysine epsilon-amino group of the target protein (PubMed : 15199155, PubMed : 16253240, PubMed : 21829689, PubMed : 21965678, PubMed : 23160374, PubMed : 24943844, PubMed : 25406032, PubMed : 29506078, PubMed : 34048572, PubMed : 37257451). Deconjugates SUMO1 from HIPK2 (PubMed : 16253240). Deconjugates SUMO1 from HDAC1 and BHLHE40/DEC1, which decreases its transcriptional repression activity (PubMed : 15199155, PubMed : 21829689). Deconjugates SUMO1 from CLOCK, which decreases its transcriptional activation activity (PubMed : 23160374). Deconjugates SUMO2 from MTA1 (PubMed : 21965678). Inhibits N(6)-methyladenosine (m6A) RNA methylation by mediating SUMO1 deconjugation from METTL3 and ALKBH5 : METTL3 inhibits the m6A RNA methyltransferase activity, while ALKBH5 desumoylation promotes m6A demethylation (PubMed : 29506078, PubMed : 34048572, PubMed : 37257451). Desumoylates CCAR2 which decreases its interaction with SIRT1 (PubMed : 25406032). Deconjugates SUMO1 from GPS2 (PubMed : 24943844).
See full target information SENP1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com