JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB161918

Recombinant Human SENP3 protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human SENP3 protein (GST tag N-Terminus) is a Human Fragment protein, in the 301 to 400 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

SSP3, SUSP3, SENP3, Sentrin-specific protease 3, SUMO-1-specific protease 3, Sentrin/SUMO-specific protease SENP3

1 Images
SDS-PAGE - Recombinant Human SENP3 protein (GST tag N-Terminus) (AB161918)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human SENP3 protein (GST tag N-Terminus) (AB161918)

ab161918 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, WB

applications

Biologically active

No

Accession

Q9H4L4

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"EKAGQHSPLREEHVTCVQSILDEFLQTYGSLIPLSTDEVVEKLEDIFQQEFSTPSRKGLVLQLIQSYQRMPGNAMVRGFRVAYKRHVLTMDDLGTLYGQN","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":400,"aminoAcidStart":301,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q9H4L4","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

SENP3 also known as SUMO-specific protease 3 is a protein with a molecular mass of about 66 kDa. It functions primarily as a protease that reverses the SUMOylation of target proteins by cleaving SUMO residues which modulate protein functions and interactions. SENP3 localizes mostly in the nucleoplasm but can also be found in the cytoplasm. The expression of SENP3 varies across different tissues displaying higher levels in the liver heart and skeletal muscle indicating its role in these tissues’ functions.
Biological function summary

SENP3 modulates SUMOylated proteins' activity influencing cellular processes such as transcription signal transduction and stress response. It is part of a larger complex with nucleophosmin a nucleolar protein that assists SENP3 in stability and substrate localization. SENP3's regulation of SUMOylation is critical for maintaining cellular homeostasis and influencing the outcome of signaling pathways related to various stimuli.

Pathways

The activity of SENP3 affects the SUMOylation cycle an important cellular mechanism for post-translational modification. SENP3 plays a role in the DNA damage response pathway where it associates with proteins like NEMO modifying their activity to facilitate repair processes. Additionally SENP3 participates in the oxidative stress response pathway where its action on transcription factors helps cells adapt to stress conditions effectively.

SENP3 is linked to cancer and cardiovascular disease. In certain cancers including hepatocellular carcinoma SENP3 levels are often upregulated leading to altered transcriptional activity and promoting tumor growth. SENP3 also interacts with proteins such as MDM2 influencing p53 degradation and impacting cell cycle regulation. In cardiovascular disease SENP3 contributes to cardiac hypertrophy through its effects on hypertrophic signaling pathways making it a potential target for therapeutic intervention.

Specifications

Form

Liquid

General info

Function

Protease that releases SUMO2 and SUMO3 monomers from sumoylated substrates, but has only weak activity against SUMO1 conjugates (PubMed : 16608850, PubMed : 32832608, PubMed : 36050397). Deconjugates SUMO2 from MEF2D, which increases its transcriptional activation capability (PubMed : 15743823). Deconjugates SUMO2 and SUMO3 from CDCA8 (PubMed : 18946085). Redox sensor that, when redistributed into nucleoplasm, can act as an effector to enhance HIF1A transcriptional activity by desumoylating EP300 (PubMed : 19680224). Required for rRNA processing through deconjugation of SUMO2 and SUMO3 from nucleophosmin, NPM1 (PubMed : 19015314). Plays a role in the regulation of sumoylation status of ZNF148 (PubMed : 18259216). Functions as a component of the Five Friends of Methylated CHTOP (5FMC) complex; the 5FMC complex is recruited to ZNF148 by methylated CHTOP, leading to desumoylation of ZNF148 and subsequent transactivation of ZNF148 target genes (PubMed : 22872859). Deconjugates SUMO2 from KAT5 (PubMed : 32832608). Catalyzes desumoylation of MRE11 (PubMed : 36050397).

Sequence similarities

Belongs to the peptidase C48 family.

Subcellular localisation

Nucleus

Product protocols

Target data

Protease that releases SUMO2 and SUMO3 monomers from sumoylated substrates, but has only weak activity against SUMO1 conjugates (PubMed : 16608850, PubMed : 32832608, PubMed : 36050397). Deconjugates SUMO2 from MEF2D, which increases its transcriptional activation capability (PubMed : 15743823). Deconjugates SUMO2 and SUMO3 from CDCA8 (PubMed : 18946085). Redox sensor that, when redistributed into nucleoplasm, can act as an effector to enhance HIF1A transcriptional activity by desumoylating EP300 (PubMed : 19680224). Required for rRNA processing through deconjugation of SUMO2 and SUMO3 from nucleophosmin, NPM1 (PubMed : 19015314). Plays a role in the regulation of sumoylation status of ZNF148 (PubMed : 18259216). Functions as a component of the Five Friends of Methylated CHTOP (5FMC) complex; the 5FMC complex is recruited to ZNF148 by methylated CHTOP, leading to desumoylation of ZNF148 and subsequent transactivation of ZNF148 target genes (PubMed : 22872859). Deconjugates SUMO2 from KAT5 (PubMed : 32832608). Catalyzes desumoylation of MRE11 (PubMed : 36050397).
See full target information SENP3

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com