JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB116977

Recombinant Human Serglycin protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Serglycin protein is a Human Full Length protein, in the 1 to 158 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

PRG, PRG1, SRGN, Serglycin, Hematopoietic proteoglycan core protein, Platelet proteoglycan core protein, Secretory granule proteoglycan core protein, P.PG

1 Images
SDS-PAGE - Recombinant Human Serglycin protein (AB116977)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Serglycin protein (AB116977)

12.5% SDS-PAGE showing ab116977 at approximately 43.45kDa.
Stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

Tag free

Applications

SDS-PAGE, ELISA, WB

applications

Biologically active

No

Accession

P10124

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.3% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MMQKLLKCSRLVLALALILVLESSVQGYPTRRARYQWVRCNPDSNSANCLEEKGPMFELLPGESNKIPRLRTDLFPKTRIQDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDYQLVDESDAFHDNLRSLDRNLPSDSQDLGQHGLEEDFML","proteinLength":"Full Length","predictedMolecularWeight":"43.45 kDa","actualMolecularWeight":null,"aminoAcidEnd":158,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P10124","tags":[]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Serglycin also known as hematopoietic proteoglycan core protein is a critical component of the extracellular matrix with a mass of approximately 17 kDa. It plays an important mechanical role by serving as a scaffold for the attachment of glycosaminoglycan (GAG) chains. These chains help serglycin mediate the storage and secretion of various bioactive molecules. It is expressed predominantly in hematopoietic cells including mast cells neutrophils and macrophages and also in endothelial cells serving diverse biological functions through its ability to interact with a wide variety of molecules.
Biological function summary

Serglycin acts as a mediator of cell granule storage and release processes. It is essential in the storage of secretory granules in mast cells and is involved in the process of degranulation where it participates in inflammation response and hemostasis. Serglycin associates with various proteins forming complexes with them to facilitate the storage of inflammatory mediators such as histamine and proteases. Its ability to bind to and sequester these bioactive molecules plays significant roles in the regulation of both innate and adaptive immune responses.

Pathways

Serglycin is an integral part of the inflammatory response pathway and the coagulation cascade. In the inflammatory pathway it modulates the release and activity of key cytokines and chemokines thereby participating in the regulation of immune cell recruitment and activation. In the coagulation cascade it interacts with protease inhibitors and various clotting factors to regulate coagulation processes. Serglycin's relationships with proteins like cathepsin G and elastase further illustrate its involvement in these pathways enhancing the modulation of inflammatory and hemostatic responses.

Aberrations in Serglycin function or expression have been linked to several conditions including asthma and certain types of leukemia. In asthma it may influence the severity of the disease through its role in the storage and release of inflammatory mediators in mast cells. In leukemia especially acute myeloid leukemia alterations in Serglycin expression can affect leukemic cell survival and proliferation. These links between Serglycin and disease states often involve interaction with other proteins like chymase and platelet factor 4 which contribute to disease processes.

Specifications

Form

Liquid

General info

Function

Plays a role in formation of mast cell secretory granules and mediates storage of various compounds in secretory vesicles. Required for storage of some proteases in both connective tissue and mucosal mast cells and for storage of granzyme B in T-lymphocytes. Plays a role in localizing neutrophil elastase in azurophil granules of neutrophils. Mediates processing of MMP2. Plays a role in cytotoxic cell granule-mediated apoptosis by forming a complex with granzyme B which is delivered to cells by perforin to induce apoptosis. Regulates the secretion of TNF-alpha and may also regulate protease secretion. Inhibits bone mineralization.

Sequence similarities

Belongs to the serglycin family.

Post-translational modifications

O-glycosylated; contains chondroitin sulfate and heparan sulfate.

Subcellular localisation

Cytolytic granule

Product protocols

Target data

Plays a role in formation of mast cell secretory granules and mediates storage of various compounds in secretory vesicles. Required for storage of some proteases in both connective tissue and mucosal mast cells and for storage of granzyme B in T-lymphocytes. Plays a role in localizing neutrophil elastase in azurophil granules of neutrophils. Mediates processing of MMP2. Plays a role in cytotoxic cell granule-mediated apoptosis by forming a complex with granzyme B which is delivered to cells by perforin to induce apoptosis. Regulates the secretion of TNF-alpha and may also regulate protease secretion. Inhibits bone mineralization.
See full target information SRGN

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com