JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB167879

Recombinant Human SET/TAF-I protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human SET/TAF-I protein (His tag N-Terminus) is a Human protein, in the 1 to 290 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

Protein SET, HLA-DR-associated protein II, Inhibitor of granzyme A-activated DNase, PHAPII, Phosphatase 2A inhibitor I2PP2A, Template-activating factor I, IGAAD, I-2PP2A, TAF-I, SET

1 Images
Western blot - Recombinant Human SET/TAF-I protein (His tag N-Terminus) (AB167879)
  • WB

Unknown

Western blot - Recombinant Human SET/TAF-I protein (His tag N-Terminus) (AB167879)

15% SDS-PAGE analysis of ab167879 (3µg).

All lanes:

Western blot - Recombinant Human SET/TAF-I protein (His tag N-Terminus) (ab167879)

false

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

Q01105

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.88% Sodium chloride, 0.32% Tris HCl, 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This product was previously labelled as SET.

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSMAPKRQSPLPPQKKKPRPPPALGPEETSASAGLPKKGEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYLVPDMDDEEGEGEEDDDDDEEEEGLEDIDEEGDEDEGEEDEDDDEGEEGEEDEGEDD","proteinLength":null,"predictedMolecularWeight":"35.93 kDa","actualMolecularWeight":null,"aminoAcidEnd":290,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q01105","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

SET/TAF-I also known as Inhibitor of Protein Phosphatase 2A (I2PP2A) is a multifunctional protein with an approximate mass of 39 kDa. It is ubiquitously expressed in various human tissues including the brain liver and testis. SET/TAF-I plays a role in chromatin remodeling and gene transcription regulation by inhibiting protein phosphatase 2A (PP2A) activity. The protein interacts with nucleosome assembly and in chromatin sliding affecting the overall structure and function of chromosomal material.
Biological function summary

In the context of cellular processes SET/TAF-I functions as a histone chaperone and is a part of the nucleosome assembly complex. This protein is involved in nucleosome disassembly and assembly during DNA replication and repair and it modulates transcriptional access for various transcription factors. It regulates the acetylation of histones influencing gene expression levels. The SET/TAF-I also participates in apoptosis and autophagy demonstrating its versatility in cellular control mechanisms.

Pathways

Studies show that SET/TAF-I engages in the MAPK/ERK signaling pathway which is critical for cell cycle progression and proliferation. It is linked with other proteins such as HMGN proteins and histone deacetylases playing a substantial role in chromatin dynamics and genomic stability. Furthermore SET/TAF-I is central to the signaling pathway that maintains normal cellular functions and responds to stress signals like oxidative stress demonstrating its importance in normal cell regulation.

Abnormalities in SET/TAF-I levels link to Alzheimer's disease and acute myeloid leukemia. In Alzheimer's the protein accumulation leads to tau hyperphosphorylation an important feature of neurodegeneration influencing PP2A's role in phosphatase activity. In acute myeloid leukemia SET/TAF-I dysregulation results in altered cell proliferation and survival signaling implicating proteins like BCL-2 and downstream apoptotic regulators. This demonstrates the protein's involvement in both neurological disorders and malignancies highlighting its broader clinical significance.

Specifications

Form

Liquid

Additional notes

ab167879 is purified using conventional chromatography techniques.

General info

Function

Multitasking protein, involved in apoptosis, transcription, nucleosome assembly and histone chaperoning. Isoform 2 anti-apoptotic activity is mediated by inhibition of the GZMA-activated DNase, NME1. In the course of cytotoxic T-lymphocyte (CTL)-induced apoptosis, GZMA cleaves SET, disrupting its binding to NME1 and releasing NME1 inhibition. Isoform 1 and isoform 2 are potent inhibitors of protein phosphatase 2A. Isoform 1 and isoform 2 inhibit EP300/CREBBP and PCAF-mediated acetylation of histones (HAT) and nucleosomes, most probably by masking the accessibility of lysines of histones to the acetylases. The predominant target for inhibition is histone H4. HAT inhibition leads to silencing of HAT-dependent transcription and prevents active demethylation of DNA. Both isoforms stimulate DNA replication of the adenovirus genome complexed with viral core proteins; however, isoform 2 specific activity is higher.

Sequence similarities

Belongs to the nucleosome assembly protein (NAP) family.

Post-translational modifications

Isoform 2 is phosphorylated on Ser-15 and Ser-24.. Isoform 2 is acetylated on Lys-11.. Some glutamate residues are glycylated by TTLL8. This modification occurs exclusively on glutamate residues and results in a glycine chain on the gamma-carboxyl group (By similarity).. N-terminus of isoform 1 is methylated by METTL11A/NTM1. Mainly trimethylated (By similarity).. Isoform 2. Cleaved after Lys-176 by GZMA. The cleavage inhibits its nucleosome assembly activity and disrupts the inhibition on NME1.

Subcellular localisation

Nucleus

Product protocols

Target data

Multitasking protein, involved in apoptosis, transcription, nucleosome assembly and histone chaperoning. Isoform 2 anti-apoptotic activity is mediated by inhibition of the GZMA-activated DNase, NME1. In the course of cytotoxic T-lymphocyte (CTL)-induced apoptosis, GZMA cleaves SET, disrupting its binding to NME1 and releasing NME1 inhibition. Isoform 1 and isoform 2 are potent inhibitors of protein phosphatase 2A. Isoform 1 and isoform 2 inhibit EP300/CREBBP and PCAF-mediated acetylation of histones (HAT) and nucleosomes, most probably by masking the accessibility of lysines of histones to the acetylases. The predominant target for inhibition is histone H4. HAT inhibition leads to silencing of HAT-dependent transcription and prevents active demethylation of DNA. Both isoforms stimulate DNA replication of the adenovirus genome complexed with viral core proteins; however, isoform 2 specific activity is higher.
See full target information SET

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com