JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB103908

Recombinant Human SF3B14 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human SF3B14 protein is a Human Full Length protein, in the 1 to 125 aa range, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

SAP14, SF3B14, SF3B14A, CGI-110, HSPC175, HT006, SF3B6, Splicing factor 3B subunit 6, Pre-mRNA branch site protein p14, SF3b 14 kDa subunit, SF3B14a

1 Images
SDS-PAGE - Recombinant Human SF3B14 protein (AB103908)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human SF3B14 protein (AB103908)

15% SDS-PAGE analysis of ab103908 (3 μg)

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

Q9Y3B4

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 30% Glycerol (glycerin, glycerine), 1.16% Sodium chloride, 0.316% Tris HCl, 0.077% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 0.0292% EDTA

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK","proteinLength":"Full Length","predictedMolecularWeight":"16.7 kDa","actualMolecularWeight":null,"aminoAcidEnd":125,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q9Y3B4","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

SF3B14 also known as Splicing Factor 3b Subunit 14 is a component of the splicing factor 3b (SF3b) complex. It has a molecular mass of approximately 14 kDa. SF3B14 is prominently expressed in various tissues with a strong presence in the nucleus where it participates in the spliceosomal machinery. Its mechanical role is to bind and stabilize pre-mRNA as a part of the spliceosome which is essential for proper splicing of precursor mRNA into mature mRNA.
Biological function summary

SF3B14 contributes to the precise assembly of the spliceosome complex being a significant component of the SF3b complex. This complex is part of the U2 small nuclear ribonucleoprotein (snRNP) within the spliceosome. SF3B14 alongside other components of the SF3b complex ensures the accurate recognition and removal of introns during gene expression. By facilitating correct splicing it plays a role in regulating gene expression levels and maintaining cell function.

Pathways

Spliceosomes and their components including SF3B14 play a role in the RNA splicing pathway. This pathway is fundamental for the modification of pre-mRNA into mature and functionally diverse mRNA. Additionally SF3B14 intersects with other spliceosomal proteins such as SF3B1 ensuring correct splice site selection. These interactions facilitate efficient mRNA processing which is essential for the flow of genetic information from DNA to proteins.

Malfunction or dysregulation of SF3B14 has connections with certain cancers including leukemia. Anomalies in the splicing process due to faulty components like SF3B14 can lead to aberrant mRNA and protein products contributing to oncogenic transformation. Additionally SF3B14 has associations with neurodegenerative disorders where disruptions in splicing patterns can affect neural cell survival. The protein SF3B1 closely linked to SF3B14 is often similarly implicated due to their shared roles within the spliceosome.

Specifications

Form

Liquid

Additional notes

Purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.

General info

Function

Component of the 17S U2 SnRNP complex of the spliceosome, a large ribonucleoprotein complex that removes introns from transcribed pre-mRNAs (PubMed : 12234937, PubMed : 27720643, PubMed : 32494006, PubMed : 34822310). The 17S U2 SnRNP complex (1) directly participates in early spliceosome assembly and (2) mediates recognition of the intron branch site during pre-mRNA splicing by promoting the selection of the pre-mRNA branch-site adenosine, the nucleophile for the first step of splicing (PubMed : 12234937, PubMed : 32494006, PubMed : 34822310). Within the 17S U2 SnRNP complex, SF3B6 is part of the SF3B subcomplex, which is required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence in pre-mRNA (PubMed : 12234937, PubMed : 27720643). Sequence independent binding of SF3A and SF3B subcomplexes upstream of the branch site is essential, it may anchor U2 snRNP to the pre-mRNA (PubMed : 12234937). Within the 17S U2 SnRNP complex, SF3B6 directly contacts the pre-mRNA branch site adenosine for the first catalytic step of splicing (PubMed : 16432215). SF3B6 stabilizes the intron branch site-U2 snRNA duplex, thereby promoting-binding of introns with poor sequence complementarity (PubMed : 34822310). Also acts as a component of the minor spliceosome, which is involved in the splicing of U12-type introns in pre-mRNAs (PubMed : 15146077, PubMed : 33509932).

Sequence similarities

Belongs to the SF3B6 family.

Subcellular localisation

Nucleus

Product protocols

Target data

Component of the 17S U2 SnRNP complex of the spliceosome, a large ribonucleoprotein complex that removes introns from transcribed pre-mRNAs (PubMed : 12234937, PubMed : 27720643, PubMed : 32494006, PubMed : 34822310). The 17S U2 SnRNP complex (1) directly participates in early spliceosome assembly and (2) mediates recognition of the intron branch site during pre-mRNA splicing by promoting the selection of the pre-mRNA branch-site adenosine, the nucleophile for the first step of splicing (PubMed : 12234937, PubMed : 32494006, PubMed : 34822310). Within the 17S U2 SnRNP complex, SF3B6 is part of the SF3B subcomplex, which is required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence in pre-mRNA (PubMed : 12234937, PubMed : 27720643). Sequence independent binding of SF3A and SF3B subcomplexes upstream of the branch site is essential, it may anchor U2 snRNP to the pre-mRNA (PubMed : 12234937). Within the 17S U2 SnRNP complex, SF3B6 directly contacts the pre-mRNA branch site adenosine for the first catalytic step of splicing (PubMed : 16432215). SF3B6 stabilizes the intron branch site-U2 snRNA duplex, thereby promoting-binding of introns with poor sequence complementarity (PubMed : 34822310). Also acts as a component of the minor spliceosome, which is involved in the splicing of U12-type introns in pre-mRNAs (PubMed : 15146077, PubMed : 33509932).
See full target information SF3B6

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com