JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB288790

Recombinant Human SFRP4 protein (Active)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human SFRP4 protein (Active) is a Human Full Length protein, in the 19 to 346 aa range, expressed in HEK 293 cells, with >95%, <0.005 EU/µg endotoxin level.

View Alternative Names

FRPHE, SFRP4, Secreted frizzled-related protein 4, sFRP-4, FrpHE

4 Images
Mass Spectrometry - Recombinant Human SFRP4 protein (Active) (AB288790)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Human SFRP4 protein (Active) (AB288790)

Mass determination by ESI-TOF.

Predicted MW is 37888.18 Da. (+/- 10 Da by ESI-TOF). Observed MW is 37893.90 Da.

Biological Activity - Recombinant Human SFRP4 protein (Active) (AB288790)
  • Biological Activity

Supplier Data

Biological Activity - Recombinant Human SFRP4 protein (Active) (AB288790)

Fully biologically active determined by the dose dependent inhibition of WNT-3a induced Wnt/ß-catenin activation in HEK293 TCF/LEF luciferase reporter cell line. ED50 is ≤ 52.4 ng/ml, corresponding to a specific activity of 1.9 x 10^4 units/mg.

HPLC - Recombinant Human SFRP4 protein (Active) (AB288790)
  • HPLC

Supplier Data

HPLC - Recombinant Human SFRP4 protein (Active) (AB288790)

HPLC analysis of ab288790

SDS-PAGE - Recombinant Human SFRP4 protein (Active) (AB288790)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human SFRP4 protein (Active) (AB288790)

SDS-PAGE analysis of ab288790

Key facts

Purity

>95% HPLC

Endotoxin level

<0.005 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Biologically active

Yes

Biological activity

Fully biologically active determined by the dose dependent inhibition of WNT-3a induced Wnt/ß-catenin activation in HEK293 TCF/LEF luciferase reporter cell line. ED50 is ≤ 52.4 ng/ml, corresponding to a specific activity of 1.9 x 104 units/mg.

Accession

Q6FHJ7

Animal free

No

Carrier free

No

Species

Human

Reconstitution

Reconstitute in PBS

Storage buffer

pH: 7.4 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Sequence info

[{"sequence":"VRGAPCEAVRIPMCRHMPWNITRMPNHLHHSTQENAILAIEQYEELVDVNCSAVLRFFLCAMYAPICTLEFLHDPIKPCKSVCQRARDDCEPLMKMYNHSWPESLACDELPVYDRGVCISPEAIVTDLPEDVKWIDITPDMMVQERPLDVDCKRLSPDRCKCKKVKPTLATYLSKNYSYVIHAKIKAVQRSGCNEVTTVVDVKEIFKSSSPIPRTQVPLITNSSCQCPHILPHQDVLIMCYEWRSRMMLLENCLVEKWRDQLSKRSIQWEERLQEQRRTVQDKKKTAGRTSRSNPPKPKGKPPAPKPASPKKNIKTRSAQKRTNPKRV","proteinLength":"Full Length","predictedMolecularWeight":"40 kDa","actualMolecularWeight":null,"aminoAcidEnd":346,"aminoAcidStart":19,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q6FHJ7","tags":[]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

SFRP4 also known as Secreted Frizzled Related Protein 4 is a 40 kDa protein involved in modulating Wnt signaling pathways. It is a member of the secreted frizzled-related proteins (sFRPs) that act as Wnt antagonists. SFRP4 has a cysteine-rich domain homologous to the Wnt-binding site on frizzled proteins. Expressed in many tissues including the heart lung and kidney SFRP4 plays a role in various physiological processes by influencing cell signaling.
Biological function summary

SFRP4 regulates cell growth and differentiation. It interacts with Wnt ligands preventing them from binding to their receptors. SFRP4 does not typically function as part of a protein complex acting instead as an antagonist on its own. By inhibiting Wnt activity SFRP4 influences embryonic development tissue homeostasis and even cancer progression. The impact of SFRP4 varies depending on the tissue-specific context reflecting its complex biological roles.

Pathways

SFRP4 is significant in the Wnt signaling pathway and the β-catenin independent pathway. By interacting with Wnt ligands SFRP4 can prevent the activation of canonical Wnt/β-catenin signaling a pathway involved in cell fate determination and stem cell renewal. It also influences the non-canonical pathways where the Wnt signaling does not involve β-catenin impacting processes like cell movement and polarity. In these pathways SFRP4 interacts with proteins such as Disheveled and Axin modulating their activities.

The disruption of SFRP4 expression links to osteoarthritis and breast cancer. Abnormal SFRP4 levels can result in improper Wnt signaling contributing to these conditions. In osteoarthritis SFRP4 imbalance affects cartilage integrity while in breast cancer altered SFRP4 expression may influence tumor growth and progression. Related proteins such as β-catenin in cancer or MMPs in osteoarthritis highlight the importance of SFRP4 in disease susceptibility and progression.

Specifications

Form

Lyophilized

General info

Function

Soluble frizzled-related proteins (sFRPS) function as modulators of Wnt signaling through direct interaction with Wnts. They have a role in regulating cell growth and differentiation in specific cell types (By similarity). SFRP4 plays a role in bone morphogenesis. May also act as a regulator of adult uterine morphology and function. May also increase apoptosis during ovulation possibly through modulation of FZ1/FZ4/WNT4 signaling (By similarity). Has phosphaturic effects by specifically inhibiting sodium-dependent phosphate uptake (PubMed : 12952927).

Sequence similarities

Belongs to the secreted frizzled-related protein (sFRP) family.

Product protocols

Target data

Soluble frizzled-related proteins (sFRPS) function as modulators of Wnt signaling through direct interaction with Wnts. They have a role in regulating cell growth and differentiation in specific cell types (By similarity). SFRP4 plays a role in bone morphogenesis. May also act as a regulator of adult uterine morphology and function. May also increase apoptosis during ovulation possibly through modulation of FZ1/FZ4/WNT4 signaling (By similarity). Has phosphaturic effects by specifically inhibiting sodium-dependent phosphate uptake (PubMed : 12952927).
See full target information SFRP4

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com