JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB161849

Recombinant Human SH2B1/PSM protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human SH2B1/PSM protein (GST tag N-Terminus) is a Human Full Length protein, in the 1 to 426 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

KIAA1299, SH2B, SH2B1, SH2B adapter protein 1, SH2 domain-containing protein 1B, PSM

1 Images
SDS-PAGE - Recombinant Human SH2B1/PSM protein (GST tag N-Terminus) (AB161849)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human SH2B1/PSM protein (GST tag N-Terminus) (AB161849)

ab161849 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, WB

applications

Biologically active

No

Accession

Q9NRF2

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This product was previously labelled as SH2B1.

Sequence info

[{"sequence":"MVQREELLSFMGAEEAAPDPAGVGRGGGVAGPPSGGGGQPQWQKCRLLLRSEGEGGGGSRLEFFVPPKASRPRLSIPCSSITDVRTTTALEMPDRENTFVVKVEGPSEYIMETVDAQHVKAWVSDIQECLSPGPCPATSPRPMTLPLAPGTSFLTRENTDSLELSCLNHSESLPSQDLLLGPSESNDRLSQGAYGGLSDRPSASISPSSASIAASHFDSMELLPPELPPRIPIEEGPPAGTVHPLSAPYPPLDTPETATGSFLFQGEPEGGEGDQPLSGYPWFHGMLSRLKAAQLALTGGTGSHGVFLVRQSETRRGEYVLTFNFQGKAKHLRLSLNEEGQCRVQHLWFQSIFDMLEHFRVHPIPLESGGSSDVVLVSYVPSSQRQQGREQAGSHAGVCEGDGCHPDASCTLMPFGASDCVTDHLP","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":426,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q9NRF2","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

SH2B1 also known as SH2B adaptor protein 1 or PSM is an adaptor protein that plays roles in cellular signaling pathways. It weighs approximately 80 kDa and is expressed in various tissues including the brain liver and muscle. This protein contains an SH2 domain PH domain and a proline-rich region which enable it to bind to receptors and other signaling proteins. SH2B1 interacts with cell surface receptors activated by growth factors and hormones modulating downstream cellular responses and signal transduction.
Biological function summary

This adaptor protein regulates processes related to energy homeostasis body weight and insulin sensitivity. SH2B1 forms part of a signaling complex that interacts with several tyrosine kinase receptors including the growth hormone receptor and insulin receptor. By binding to these receptors SH2B1 enhances their kinase activity thereby promoting cell growth differentiation and metabolic regulation. Its role is critical in maintaining normal metabolic processes and preventing metabolic disorders.

Pathways

The protein SH2B1 serves integral functions in the insulin signaling pathway and the JAK-STAT pathway. In the insulin signaling pathway SH2B1 facilitates interactions with the insulin receptor which amplifies the signaling cascade necessary for glucose uptake and metabolism. SH2B1 also plays a role in the JAK-STAT pathway by interacting with growth hormone receptors which influences cell proliferation and immune responses. In these pathways SH2B1 interacts with other proteins such as STAT5 and IRS1 which are essential for transmitting signals downstream.

SH2B1 links to obesity and type 2 diabetes both of which involve dysregulation of energy balance and insulin sensitivity. Mutations and alterations in SH2B1 can disrupt normal signaling in pathways resulting in increased risk and manifestation of these metabolic disorders. The protein also links to leptin another protein involved in appetite regulation and energy expenditure. Researchers continue to study the precise mechanisms of SH2B1 in these disease contexts to uncover therapeutic targets and interventions.

Specifications

Form

Liquid

General info

Function

Adapter protein for several members of the tyrosine kinase receptor family. Involved in multiple signaling pathways mediated by Janus kinase (JAK) and receptor tyrosine kinases, including the receptors of insulin (INS), insulin-like growth factor 1 (IGF1), nerve growth factor (NGF), brain-derived neurotrophic factor (BDNF), glial cell line-derived neurotrophic factor (GDNF), platelet-derived growth factor (PDGF) and fibroblast growth factors (FGFs). In growth hormone (GH) signaling, autophosphorylated ('Tyr-813') JAK2 recruits SH2B1, which in turn is phosphorylated by JAK2 on tyrosine residues. These phosphotyrosines form potential binding sites for other signaling proteins. GH also promotes serine/threonine phosphorylation of SH2B1 and these phosphorylated residues may serve to recruit other proteins to the GHR-JAK2-SH2B1 complexes, such as RAC1. In leptin (LEP) signaling, binds to and potentiates the activation of JAK2 by globally enhancing downstream pathways. In response to leptin, binds simultaneously to both, JAK2 and IRS1 or IRS2, thus mediating formation of a complex of JAK2, SH2B1 and IRS1 or IRS2. Mediates tyrosine phosphorylation of IRS1 and IRS2, resulting in activation of the PI 3-kinase pathway. Acts as a positive regulator of NGF-mediated activation of the Akt/Forkhead pathway; prolongs NGF-induced phosphorylation of AKT1 on 'Ser-473' and AKT1 enzymatic activity. Enhances the kinase activity of the cytokine receptor-associated tyrosine kinase JAK2 and of other receptor tyrosine kinases, such as FGFR3 and NTRK1. For JAK2, the mechanism seems to involve dimerization of both, SH2B1 and JAK2. Enhances RET phosphorylation and kinase activity. Isoforms seem to be differentially involved in IGF1 and PDGF-induced mitogenesis (By similarity).

Sequence similarities

Belongs to the SH2B adapter family.

Post-translational modifications

Phosphorylated on tyrosine residues in response to receptor kinase stimulation. Phosphorylated by RET.

Subcellular localisation

Nucleus

Product protocols

Target data

Adapter protein for several members of the tyrosine kinase receptor family. Involved in multiple signaling pathways mediated by Janus kinase (JAK) and receptor tyrosine kinases, including the receptors of insulin (INS), insulin-like growth factor 1 (IGF1), nerve growth factor (NGF), brain-derived neurotrophic factor (BDNF), glial cell line-derived neurotrophic factor (GDNF), platelet-derived growth factor (PDGF) and fibroblast growth factors (FGFs). In growth hormone (GH) signaling, autophosphorylated ('Tyr-813') JAK2 recruits SH2B1, which in turn is phosphorylated by JAK2 on tyrosine residues. These phosphotyrosines form potential binding sites for other signaling proteins. GH also promotes serine/threonine phosphorylation of SH2B1 and these phosphorylated residues may serve to recruit other proteins to the GHR-JAK2-SH2B1 complexes, such as RAC1. In leptin (LEP) signaling, binds to and potentiates the activation of JAK2 by globally enhancing downstream pathways. In response to leptin, binds simultaneously to both, JAK2 and IRS1 or IRS2, thus mediating formation of a complex of JAK2, SH2B1 and IRS1 or IRS2. Mediates tyrosine phosphorylation of IRS1 and IRS2, resulting in activation of the PI 3-kinase pathway. Acts as a positive regulator of NGF-mediated activation of the Akt/Forkhead pathway; prolongs NGF-induced phosphorylation of AKT1 on 'Ser-473' and AKT1 enzymatic activity. Enhances the kinase activity of the cytokine receptor-associated tyrosine kinase JAK2 and of other receptor tyrosine kinases, such as FGFR3 and NTRK1. For JAK2, the mechanism seems to involve dimerization of both, SH2B1 and JAK2. Enhances RET phosphorylation and kinase activity. Isoforms seem to be differentially involved in IGF1 and PDGF-induced mitogenesis (By similarity).
See full target information SH2B1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com