JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB226887

Recombinant Human SH2D1B protein (His tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human SH2D1B protein (His tag) is a Human Full Length protein, in the 1 to 132 aa range, expressed in Baculovirus infected insect cells, with >90%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

EAT2, SH2D1B, SH2 domain-containing protein 1B, EWS/FLI1-activated transcript 2, EAT-2

1 Images
SDS-PAGE - Recombinant Human SH2D1B protein (His tag) (AB226887)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human SH2D1B protein (His tag) (AB226887)

15% SDS-PAGE analysis of 3 μg ab226887.

MW : 18-28 kDa (SDS-PAGE under reducing conditions).

Key facts

Purity

>90% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

Baculovirus infected insect cells

Tags

His tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

O14796

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: PBS, 20% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"ADPMDLPYYHGRLTKQDCETLLLKEGVDGNFLLRDSESIPGVLCLCVSFKNIVYTYRIFREKHGYYRIQTAEGSPKQVFPSLKELISKFEKPNQGMVVHLLKPIKRTSPSLRWRGLKLELETFVNSNSDYVDVLPHHHHHH","proteinLength":"Full Length","predictedMolecularWeight":"16.4 kDa","actualMolecularWeight":null,"aminoAcidEnd":132,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Baculovirus infected insect cells","accessionNumber":"O14796","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

SH2D1B also known as EAT-2 is an adaptor protein that has a significant role in immune cell signaling. It is about 15 kDa in size and contains a single SH2 domain which allows it to interact with phosphorylated tyrosine-containing proteins. SH2D1B is mainly expressed in natural killer (NK) cells and some T-cell populations. In these cells SH2D1B modulates signaling pathways by interacting with various receptors and other signaling proteins affecting cellular responses.
Biological function summary

SH2D1B influences immune cell activation and effector functions. It is part of a signaling complex that modulates the activity of NK cells and some T-cells influencing processes like cytotoxicity and cytokine production. By participating in this complex SH2D1B plays a role in regulating immune responses affecting conditions ranging from viral infections to cancer surveillance where adaptive immunity is modified.

Pathways

SH2D1B is involved in the regulation of the SLAM family receptor signaling pathway which is vital for the activation and function of NK cells. It interacts closely with other proteins in this pathway such as SAP (SLAM-associated protein) to influence signaling cascades that determine cell fate and activity. SH2D1B also participates in the NF-kB signaling pathway further affecting immune responses through modulation of gene expression involved in cell survival and differentiation.

SH2D1B has associations with immune system dysfunctions such as X-linked lymphoproliferative syndrome (XLP). This disorder involves unregulated immune responses and is linked to an overactive or misregulated SLAM receptor signaling where SH2D1B collaborates with SAP. Additionally variations in SH2D1B expression or function have potential links to autoimmune diseases due to its role in regulatory pathways of immune activation and suppression.

Specifications

Form

Liquid

Additional notes

Affinity purified

General info

Function

Cytoplasmic adapter regulating receptors of the signaling lymphocytic activation molecule (SLAM) family such as CD84, SLAMF1, LY9 and CD244 (PubMed : 11689425). In SLAM signaling seems to cooperate with SH2D1A/SAP. Plays a role in regulation of effector functions of natural killer (NK) cells by controlling signal transduction through CD244/2B4 without effecting its tyrosine phosphorylation; downstream signaling involves PLCG1 and ERK activation (PubMed : 24687958). Activation of SLAMF7-mediated NK cell function does not effect receptor tyrosine phosphorylation but distal signaling (By similarity). In the context of NK cell-mediated cytotoxicity does not enhance conjugate formation with target cells but stimulates polarization of the microtubule-organizing center and cytotoxic granules toward the NK cell synapse (PubMed : 24687958). Negatively regulates CD40-induced cytokine production in dendritic cells downstream of SLAM family receptors probably by inducing activation of the PI3K pathway to inhibit p38 MAPK and JNK activation (By similarity).

Product protocols

Target data

Cytoplasmic adapter regulating receptors of the signaling lymphocytic activation molecule (SLAM) family such as CD84, SLAMF1, LY9 and CD244 (PubMed : 11689425). In SLAM signaling seems to cooperate with SH2D1A/SAP. Plays a role in regulation of effector functions of natural killer (NK) cells by controlling signal transduction through CD244/2B4 without effecting its tyrosine phosphorylation; downstream signaling involves PLCG1 and ERK activation (PubMed : 24687958). Activation of SLAMF7-mediated NK cell function does not effect receptor tyrosine phosphorylation but distal signaling (By similarity). In the context of NK cell-mediated cytotoxicity does not enhance conjugate formation with target cells but stimulates polarization of the microtubule-organizing center and cytotoxic granules toward the NK cell synapse (PubMed : 24687958). Negatively regulates CD40-induced cytokine production in dendritic cells downstream of SLAM family receptors probably by inducing activation of the PI3K pathway to inhibit p38 MAPK and JNK activation (By similarity).
See full target information SH2D1B

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com