JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB288810

Recombinant Human SHH protein (Active)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human SHH protein (Active) is a Human Full Length protein, in the 24 to 197 aa range, expressed in HEK 293 cells, with >95%, <0.005 EU/µg endotoxin level.

View Alternative Names

Sonic hedgehog protein, SHH, HHG-1, Shh unprocessed N-terminal signaling and C-terminal autoprocessing domains, ShhNC

4 Images
Mass Spectrometry - Recombinant Human SHH protein (Active) (AB288810)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Human SHH protein (Active) (AB288810)

Mass determination by ESI-TOF.

Predicted MW is 19617 Da. (+/- 10 Da by ESI-TOF). Observed MW is 19618.04 Da.

Biological Activity - Recombinant Human SHH protein (Active) (AB288810)
  • Biological Activity

Supplier Data

Biological Activity - Recombinant Human SHH protein (Active) (AB288810)

Fully biologically active determined by its ability to induce alkaline phosphatase production by CCL-226 cells.

ED50 is >10 ug/ml, corresponding to a specific activity of 1 x 102 units/mg.

HPLC - Recombinant Human SHH protein (Active) (AB288810)
  • HPLC

Supplier Data

HPLC - Recombinant Human SHH protein (Active) (AB288810)

HPLC analysis of ab288810

SDS-PAGE - Recombinant Human SHH protein (Active) (AB288810)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human SHH protein (Active) (AB288810)

SDS-PAGE analysis of ab288810

Key facts

Purity

>95% HPLC

Endotoxin level

<0.005 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Biologically active

Yes

Biological activity

Fully biologically active determined by its ability to induce alkaline phosphatase production by CCL-226 cells.

ED50 is >10 ug/ml, corresponding to a specific activity of 1 x 102 units/mg.

Accession

Q15465

Animal free

No

Carrier free

No

Species

Human

Reconstitution

Reconstitute in PBS

Storage buffer

pH: 7.4 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

You may be interested in:

AB100639

Human Sonic Hedgehog ELISA Kit

4

1 Reviews

View product

We recommend this product because it’s often used in the same experiment or related research.

We advise that you always check the datasheet to ensure it fits your experiments, or contact ourtechnical teamfor help.

Sequence info

[{"sequence":"CGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":197,"aminoAcidStart":24,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q15465","tags":[]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
True

Specifications

Form

Lyophilized

General info

Function

Sonic hedgehog protein. The C-terminal part of the sonic hedgehog protein precursor displays an autoproteolysis and a cholesterol transferase activity (By similarity). Both activities result in the cleavage of the full-length protein into two parts (ShhN and ShhC) followed by the covalent attachment of a cholesterol moiety to the C-terminal of the newly generated ShhN (By similarity). Both activities occur in the reticulum endoplasmic (By similarity). Once cleaved, ShhC is degraded in the endoplasmic reticulum (By similarity).. Sonic hedgehog protein N-product. The dually lipidated sonic hedgehog protein N-product (ShhNp) is a morphogen which is essential for a variety of patterning events during development. Induces ventral cell fate in the neural tube and somites (PubMed : 24863049). Involved in the patterning of the anterior-posterior axis of the developing limb bud (By similarity). Essential for axon guidance (By similarity). Binds to the patched (PTCH1) receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes (PubMed : 10753901). In the absence of SHH, PTCH1 represses the constitutive signaling activity of SMO (PubMed : 10753901).

Sequence similarities

Belongs to the hedgehog family.

Post-translational modifications

Sonic hedgehog protein. The C-terminal domain displays an autoproteolysis activity and a cholesterol transferase activity (By similarity). Both activities result in the cleavage of the full-length protein and covalent attachment of a cholesterol moiety to the C-terminal of the newly generated N-terminal fragment (ShhN) (By similarity). Cholesterylation is required for the sonic hedgehog protein N-product targeting to lipid rafts and multimerization (PubMed:24522195, PubMed:26875496). ShhN is the active species in both local and long-range signaling, whereas the C-product (ShhC) is degraded in the reticulum endoplasmic (By similarity).. Sonic hedgehog protein N-product. N-palmitoylation by HHAT of ShhN is required for sonic hedgehog protein N-product multimerization and full activity (By similarity). It is a prerequisite for the membrane-proximal positioning and the subsequent shedding of this N-terminal peptide (PubMed:24522195).. Sonic hedgehog protein N-product. The lipidated N- and C-terminal peptides of ShhNp can be cleaved (shedding) (PubMed:24522195). The N-terminal palmitoylated peptide is cleaved at the Cardin-Weintraub (CW) motif site (PubMed:24522195). The cleavage reduced the interactions with heparan sulfate. The cleavage is enhanced by SCUBE2 (PubMed:23118222, PubMed:24522195).

Product protocols

Target data

Sonic hedgehog protein. The C-terminal part of the sonic hedgehog protein precursor displays an autoproteolysis and a cholesterol transferase activity (By similarity). Both activities result in the cleavage of the full-length protein into two parts (ShhN and ShhC) followed by the covalent attachment of a cholesterol moiety to the C-terminal of the newly generated ShhN (By similarity). Both activities occur in the reticulum endoplasmic (By similarity). Once cleaved, ShhC is degraded in the endoplasmic reticulum (By similarity).. Sonic hedgehog protein N-product. The dually lipidated sonic hedgehog protein N-product (ShhNp) is a morphogen which is essential for a variety of patterning events during development. Induces ventral cell fate in the neural tube and somites (PubMed : 24863049). Involved in the patterning of the anterior-posterior axis of the developing limb bud (By similarity). Essential for axon guidance (By similarity). Binds to the patched (PTCH1) receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes (PubMed : 10753901). In the absence of SHH, PTCH1 represses the constitutive signaling activity of SMO (PubMed : 10753901).
See full target information SHH

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com