JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB164780

Recombinant Human SIGLEC10 protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human SIGLEC10 protein (GST tag N-Terminus) is a Human Fragment protein, in the 589 to 696 aa range, expressed in Wheat germ, with >80%, suitable for ELISA, WB.

View Alternative Names

SLG2, UNQ477/PRO940, SIGLEC10, Sialic acid-binding Ig-like lectin 10, Siglec-10, Siglec-like protein 2

1 Images
SDS-PAGE - Recombinant Human SIGLEC10 protein (GST tag N-Terminus) (AB164780)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human SIGLEC10 protein (GST tag N-Terminus) (AB164780)

ab164780 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Purity

>80%

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, ELISA

applications

Biologically active

No

Accession

Q96LC7

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"SRHSTILDYINVVPTAGPLAQKRNQKATPNSPRTPLPPGAPSPESKKNQKKQYQLPSFPEPKSSTQAPESQESQEELHYATLNFPGVRPRPEARMPKGTQADYAEVKF","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":696,"aminoAcidStart":589,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q96LC7","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

SIGLEC10 also known as sialic acid-binding Ig-like lectin 10 is a membrane protein that identifies sialic acid-containing glycoproteins. It weighs about 135 kiloDaltons. SIGLEC10 is expressed in various human tissues especially in immune cells like monocytes B cells and dendritic cells. It is a part of the immunoglobulin superfamily featuring sialic acid-binding sites that enable interaction with sialylated glycans on the surface of cells contributing to cell-cell communication and regulation of immune response.
Biological function summary

SIGLEC10 functions as an inhibitory receptor acting to dampen immune responses. It plays a role in immune self-tolerance and modulation of excessive immune activation by binding to its ligands such as CD24. This interaction helps to protect tissues from damage during inflammation. SIGLEC10 acts in cooperation with other molecules like ITIM domain-containing proteins which through their signaling pathways mediate negative regulation. Although not part of a complex it effectively collaborates with various immune system components to maintain homeostasis.

Pathways

SIGLEC10 is integrally involved in immune regulation pathways specifically by participating in inhibitory signaling pathways. One of the key pathways is the CD24-SIGLEC10 axis which modulates inflammatory responses. Through this pathway SIGLEC10 engages with proteins like DAP12 (TYROBP) and SHP-1 facilitating downstream signaling that leads to immune response suppression. Furthermore it plays an indirect role in the Toll-like receptor pathway by limiting excessive inflammation functioning in harmony with CD24 and other ligands.

SIGLEC10 plays a role in cancer and autoimmune conditions. In cancer tumors exploit SIGLEC10's regulatory functions to evade immune surveillance—often seen in breast and ovarian cancers where CD24 expressed on tumor cells interacts with SIGLEC10 on immune cells. This interaction can hinder effective anti-tumor responses. In autoimmune disorders the dysfunction or altered expression of SIGLEC10 may contribute to the breakdown of self-tolerance potentially exacerbating conditions like rheumatoid arthritis. The relationship between SIGLEC10 and proteins like CD24 is central in these pathogenic processes emphasizing their role in disease contexts.

Specifications

Form

Liquid

Additional notes

Glutathione Sepharose

General info

Function

Putative adhesion molecule that mediates sialic-acid dependent binding to cells. Preferentially binds to alpha-2,3- or alpha-2,6-linked sialic acid (By similarity). The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. In the immune response, seems to act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules (PubMed : 11284738, PubMed : 12163025). Involved in negative regulation of B-cell antigen receptor signaling. The inhibition of B cell activation is dependent on PTPN6/SHP-1 (By similarity). In association with CD24 may be involved in the selective suppression of the immune response to danger-associated molecular patterns (DAMPs) such as HMGB1, HSP70 and HSP90 (By similarity). In association with CD24 may regulate the immune repsonse of natural killer (NK) cells (PubMed : 25450598). Plays a role in the control of autoimmunity (By similarity). During initiation of adaptive immune responses by CD8-alpha(+) dendritic cells inhibits cross-presentation by impairing the formation of MHC class I-peptide complexes. The function seems to implicate recruitment of PTPN6/SHP-1, which dephosphorylates NCF1 of the NADPH oxidase complex consequently promoting phagosomal acidification (By similarity).

Sequence similarities

Belongs to the immunoglobulin superfamily. SIGLEC (sialic acid binding Ig-like lectin) family.

Post-translational modifications

Phosphorylation of Tyr-667 is involved in binding to PTPN6.

Product protocols

Target data

Putative adhesion molecule that mediates sialic-acid dependent binding to cells. Preferentially binds to alpha-2,3- or alpha-2,6-linked sialic acid (By similarity). The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. In the immune response, seems to act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules (PubMed : 11284738, PubMed : 12163025). Involved in negative regulation of B-cell antigen receptor signaling. The inhibition of B cell activation is dependent on PTPN6/SHP-1 (By similarity). In association with CD24 may be involved in the selective suppression of the immune response to danger-associated molecular patterns (DAMPs) such as HMGB1, HSP70 and HSP90 (By similarity). In association with CD24 may regulate the immune repsonse of natural killer (NK) cells (PubMed : 25450598). Plays a role in the control of autoimmunity (By similarity). During initiation of adaptive immune responses by CD8-alpha(+) dendritic cells inhibits cross-presentation by impairing the formation of MHC class I-peptide complexes. The function seems to implicate recruitment of PTPN6/SHP-1, which dephosphorylates NCF1 of the NADPH oxidase complex consequently promoting phagosomal acidification (By similarity).
See full target information SIGLEC10

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com