JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB79948

Recombinant human SIRT2 protein (His tag C-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human SIRT2 protein (His tag C-Terminus) is a Human Fragment protein, in the 50 to 356 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, FuncS.

View Alternative Names

SIR2L, SIR2L2, SIRT2, NAD-dependent protein deacetylase sirtuin-2, NAD-dependent protein defatty-acylase sirtuin-2, Regulatory protein SIR2 homolog 2, SIR2-like protein 2

2 Images
Functional Studies - Recombinant human SIRT2 protein (His tag C-Terminus) (AB79948)
  • FuncS

Unknown

Functional Studies - Recombinant human SIRT2 protein (His tag C-Terminus) (AB79948)

Image showing specific activity of ab79948.

SDS-PAGE - Recombinant human SIRT2 protein (His tag C-Terminus) (AB79948)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant human SIRT2 protein (His tag C-Terminus) (AB79948)

12% SDS-PAGE, Coomassie staining.

Lane 1 : ab79948 1μg.
Lane 2 : ab79948 2μg.
Lane 3 : Protein marker.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag C-Terminus

Applications

FuncS, SDS-PAGE

applications

Biologically active

Yes

Biological activity

Specific Activity: 1.4 U/μg. One U =1 pmol/min.

Activity: =1.0 pmol/min/μg. Assay conditions: 25 mM Tris/HCl, pH 8.0, 137 mM NaCl, 2.7 mM KCl, 1 mM MgCl2, and 0.1 mg/ml BSA, 20 μM BPS HDAC substrate, 500 μM NAD+ and Sirtuin 2 (125 - 8000 ng). Incubation condition: 30 min at 37°C followed by treatment with 50 μl of SIRT developer for 15 min at RT. Fluorescence intensity is measured at ex360/em460.

Accession

Q8IXJ6

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 50% Glycerol (glycerin, glycerine), 0.58% Sodium chloride, 0.395% Tris HCl, 0.05% Sorbitan monolaurate, ethoxylated, 0.0462% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MASSLGSQKERLLDELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFRSPSTGLYDNLEKYHLPYPEAIFEISYFKKHPEPFFALAKELYPGQFKPTICHYFMRLLKDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLSTPRLLINKEKAGQSDPFLGMIMGLGGGMDFDSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQSLEHHHHHH","proteinLength":"Fragment","predictedMolecularWeight":"36 kDa","actualMolecularWeight":null,"aminoAcidEnd":356,"aminoAcidStart":50,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q8IXJ6","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

SIRT2 also known as Sirtuin 2 is a member of the sirtuin family of proteins which are NAD+-dependent deacetylases known for regulating various cellular processes. SIRT2 has a molecular mass of approximately 43 kDa. Its expression is prominent in the cytoplasm but can also be found in the nucleus of cells particularly in the brain and liver tissues. The protein deacetylates various substrates influencing cellular processes including aging metabolism and neurodegeneration.
Biological function summary

SIRT2 contributes to the regulation of cellular homeostasis and stress responses. This protein acts as a deacetylase modulating the acetylation status of key proteins and participates in various signaling pathways. It functions as part of a larger protein complex and interacts with substrates that include tubulin and histones. These interactions help SIRT2 control processes such as cell cycle differentiation and proliferation indicating its importance in maintaining normal cellular function.

Pathways

SIRT2 plays an essential role in the insulin signaling pathway and the FoxO transcription factor pathway. In these pathways SIRT2 interacts with other sirtuins like SIRT1 which helps regulate metabolic homeostasis and oxidative stress responses. SIRT2's activity in deacetylating proteins such as p53 impacts cellular responses to DNA damage and genomic stability further integrating it into critical regulatory networks within the cell.

SIRT2 relates to neurodegenerative diseases like Parkinson's disease and metabolic disorders such as obesity. Its involvement in deacetylating alpha-synuclein links SIRT2 to Parkinson's disease pathogenesis. In metabolic disorders abnormalities in SIRT2 activity can affect glucose and lipid metabolism connecting it with proteins like acetyl-CoA carboxylase. Understanding SIRT2's function offers potential therapeutic targets for these conditions and highlights its importance in disease regulation.

Specifications

Form

Liquid

General info

Function

NAD-dependent protein deacetylase, which deacetylates internal lysines on histone and alpha-tubulin as well as many other proteins such as key transcription factors (PubMed : 12620231, PubMed : 16648462, PubMed : 18249187, PubMed : 18332217, PubMed : 18995842, PubMed : 20543840, PubMed : 20587414, PubMed : 21081649, PubMed : 21726808, PubMed : 21949390, PubMed : 22014574, PubMed : 22771473, PubMed : 23468428, PubMed : 23908241, PubMed : 24177535, PubMed : 24681946, PubMed : 24769394, PubMed : 24940000). Participates in the modulation of multiple and diverse biological processes such as cell cycle control, genomic integrity, microtubule dynamics, cell differentiation, metabolic networks, and autophagy (PubMed : 12620231, PubMed : 16648462, PubMed : 18249187, PubMed : 18332217, PubMed : 18995842, PubMed : 20543840, PubMed : 20587414, PubMed : 21081649, PubMed : 21726808, PubMed : 21949390, PubMed : 22014574, PubMed : 22771473, PubMed : 23468428, PubMed : 23908241, PubMed : 24177535, PubMed : 24681946, PubMed : 24769394, PubMed : 24940000). Plays a major role in the control of cell cycle progression and genomic stability (PubMed : 12697818, PubMed : 16909107, PubMed : 17488717, PubMed : 17726514, PubMed : 19282667, PubMed : 23468428). Functions in the antephase checkpoint preventing precocious mitotic entry in response to microtubule stress agents, and hence allowing proper inheritance of chromosomes (PubMed : 12697818, PubMed : 16909107, PubMed : 17488717, PubMed : 17726514, PubMed : 19282667, PubMed : 23468428). Positively regulates the anaphase promoting complex/cyclosome (APC/C) ubiquitin ligase complex activity by deacetylating CDC20 and FZR1, then allowing progression through mitosis (PubMed : 22014574). Associates both with chromatin at transcriptional start sites (TSSs) and enhancers of active genes (PubMed : 23468428). Plays a role in cell cycle and chromatin compaction through epigenetic modulation of the regulation of histone H4 'Lys-20' methylation (H4K20me1) during early mitosis (PubMed : 23468428). Specifically deacetylates histone H4 at 'Lys-16' (H4K16ac) between the G2/M transition and metaphase enabling H4K20me1 deposition by KMT5A leading to ulterior levels of H4K20me2 and H4K20me3 deposition throughout cell cycle, and mitotic S-phase progression (PubMed : 23468428). Deacetylates KMT5A modulating KMT5A chromatin localization during the mitotic stress response (PubMed : 23468428). Deacetylates also histone H3 at 'Lys-57' (H3K56ac) during the mitotic G2/M transition (PubMed : 20587414). Upon bacterium Listeria monocytogenes infection, deacetylates 'Lys-18' of histone H3 in a receptor tyrosine kinase MET- and PI3K/Akt-dependent manner, thereby inhibiting transcriptional activity and promoting late stages of listeria infection (PubMed : 23908241). During oocyte meiosis progression, may deacetylate histone H4 at 'Lys-16' (H4K16ac) and alpha-tubulin, regulating spindle assembly and chromosome alignment by influencing microtubule dynamics and kinetochore function (PubMed : 24940000). Deacetylates histone H4 at 'Lys-16' (H4K16ac) at the VEGFA promoter and thereby contributes to regulate expression of VEGFA, a key regulator of angiogenesis (PubMed : 24940000). Deacetylates alpha-tubulin at 'Lys-40' and hence controls neuronal motility, oligodendroglial cell arbor projection processes and proliferation of non-neuronal cells (PubMed : 18332217, PubMed : 18995842). Phosphorylation at Ser-368 by a G1/S-specific cyclin E-CDK2 complex inactivates SIRT2-mediated alpha-tubulin deacetylation, negatively regulating cell adhesion, cell migration and neurite outgrowth during neuronal differentiation (PubMed : 17488717). Deacetylates PARD3 and participates in the regulation of Schwann cell peripheral myelination formation during early postnatal development and during postinjury remyelination (PubMed : 21949390). Involved in several cellular metabolic pathways (PubMed : 20543840, PubMed : 21726808, PubMed : 24769394). Plays a role in the regulation of blood glucose homeostasis by deacetylating and stabilizing phosphoenolpyruvate carboxykinase PCK1 activity in response to low nutrient availability (PubMed : 21726808). Acts as a key regulator in the pentose phosphate pathway (PPP) by deacetylating and activating the glucose-6-phosphate G6PD enzyme, and therefore, stimulates the production of cytosolic NADPH to counteract oxidative damage (PubMed : 24769394). Maintains energy homeostasis in response to nutrient deprivation as well as energy expenditure by inhibiting adipogenesis and promoting lipolysis (PubMed : 20543840). Attenuates adipocyte differentiation by deacetylating and promoting FOXO1 interaction to PPARG and subsequent repression of PPARG-dependent transcriptional activity (PubMed : 20543840). Plays a role in the regulation of lysosome-mediated degradation of protein aggregates by autophagy in neuronal cells (PubMed : 20543840). Deacetylates FOXO1 in response to oxidative stress or serum deprivation, thereby negatively regulating FOXO1-mediated autophagy (PubMed : 20543840). Deacetylates a broad range of transcription factors and co-regulators regulating target gene expression. Deacetylates transcriptional factor FOXO3 stimulating the ubiquitin ligase SCF(SKP2)-mediated FOXO3 ubiquitination and degradation (By similarity). Deacetylates HIF1A and therefore promotes HIF1A degradation and inhibition of HIF1A transcriptional activity in tumor cells in response to hypoxia (PubMed : 24681946). Deacetylates RELA in the cytoplasm inhibiting NF-kappaB-dependent transcription activation upon TNF-alpha stimulation (PubMed : 21081649). Inhibits transcriptional activation by deacetylating p53/TP53 and EP300 (PubMed : 18249187, PubMed : 18995842). Deacetylates also EIF5A (PubMed : 22771473). Functions as a negative regulator on oxidative stress-tolerance in response to anoxia-reoxygenation conditions (PubMed : 24769394). Plays a role as tumor suppressor (PubMed : 22014574). In addition to protein deacetylase activity, also has activity toward long-chain fatty acyl groups and mediates protein-lysine demyristoylation and depalmitoylation of target proteins, such as ARF6 and KRAS, thereby regulating their association with membranes (PubMed : 25704306, PubMed : 29239724, PubMed : 32103017).. Isoform 1. Deacetylates EP300, alpha-tubulin and histone H3 and H4.. Isoform 2. Deacetylates EP300, alpha-tubulin and histone H3 and H4.. Isoform 5. Lacks deacetylation activity, at least toward known SIRT2 targets.

Sequence similarities

Belongs to the sirtuin family. Class I subfamily.

Post-translational modifications

Phosphorylated at phosphoserine and phosphothreonine. Phosphorylated at Ser-368 by a mitotic kinase CDK1/cyclin B at the G2/M transition; phosphorylation regulates the delay in cell-cycle progression. Phosphorylated at Ser-368 by a mitotic kinase G1/S-specific cyclin E/Cdk2 complex; phosphorylation inactivates SIRT2-mediated alpha-tubulin deacetylation and thereby negatively regulates cell adhesion, cell migration and neurite outgrowth during neuronal differentiation. Phosphorylated by cyclin A/Cdk2 and p35-Cdk5 complexes and to a lesser extent by the cyclin D3/Cdk4 and cyclin B/Cdk1, in vitro. Dephosphorylated at Ser-368 by CDC14A and CDC14B around early anaphase.. Acetylated by EP300; acetylation leads both to the decreased of SIRT2-mediated alpha-tubulin deacetylase activity and SIRT2-mediated down-regulation of TP53 transcriptional activity.. Ubiquitinated.

Subcellular localisation

Nucleus

Product protocols

Target data

NAD-dependent protein deacetylase, which deacetylates internal lysines on histone and alpha-tubulin as well as many other proteins such as key transcription factors (PubMed : 12620231, PubMed : 16648462, PubMed : 18249187, PubMed : 18332217, PubMed : 18995842, PubMed : 20543840, PubMed : 20587414, PubMed : 21081649, PubMed : 21726808, PubMed : 21949390, PubMed : 22014574, PubMed : 22771473, PubMed : 23468428, PubMed : 23908241, PubMed : 24177535, PubMed : 24681946, PubMed : 24769394, PubMed : 24940000). Participates in the modulation of multiple and diverse biological processes such as cell cycle control, genomic integrity, microtubule dynamics, cell differentiation, metabolic networks, and autophagy (PubMed : 12620231, PubMed : 16648462, PubMed : 18249187, PubMed : 18332217, PubMed : 18995842, PubMed : 20543840, PubMed : 20587414, PubMed : 21081649, PubMed : 21726808, PubMed : 21949390, PubMed : 22014574, PubMed : 22771473, PubMed : 23468428, PubMed : 23908241, PubMed : 24177535, PubMed : 24681946, PubMed : 24769394, PubMed : 24940000). Plays a major role in the control of cell cycle progression and genomic stability (PubMed : 12697818, PubMed : 16909107, PubMed : 17488717, PubMed : 17726514, PubMed : 19282667, PubMed : 23468428). Functions in the antephase checkpoint preventing precocious mitotic entry in response to microtubule stress agents, and hence allowing proper inheritance of chromosomes (PubMed : 12697818, PubMed : 16909107, PubMed : 17488717, PubMed : 17726514, PubMed : 19282667, PubMed : 23468428). Positively regulates the anaphase promoting complex/cyclosome (APC/C) ubiquitin ligase complex activity by deacetylating CDC20 and FZR1, then allowing progression through mitosis (PubMed : 22014574). Associates both with chromatin at transcriptional start sites (TSSs) and enhancers of active genes (PubMed : 23468428). Plays a role in cell cycle and chromatin compaction through epigenetic modulation of the regulation of histone H4 'Lys-20' methylation (H4K20me1) during early mitosis (PubMed : 23468428). Specifically deacetylates histone H4 at 'Lys-16' (H4K16ac) between the G2/M transition and metaphase enabling H4K20me1 deposition by KMT5A leading to ulterior levels of H4K20me2 and H4K20me3 deposition throughout cell cycle, and mitotic S-phase progression (PubMed : 23468428). Deacetylates KMT5A modulating KMT5A chromatin localization during the mitotic stress response (PubMed : 23468428). Deacetylates also histone H3 at 'Lys-57' (H3K56ac) during the mitotic G2/M transition (PubMed : 20587414). Upon bacterium Listeria monocytogenes infection, deacetylates 'Lys-18' of histone H3 in a receptor tyrosine kinase MET- and PI3K/Akt-dependent manner, thereby inhibiting transcriptional activity and promoting late stages of listeria infection (PubMed : 23908241). During oocyte meiosis progression, may deacetylate histone H4 at 'Lys-16' (H4K16ac) and alpha-tubulin, regulating spindle assembly and chromosome alignment by influencing microtubule dynamics and kinetochore function (PubMed : 24940000). Deacetylates histone H4 at 'Lys-16' (H4K16ac) at the VEGFA promoter and thereby contributes to regulate expression of VEGFA, a key regulator of angiogenesis (PubMed : 24940000). Deacetylates alpha-tubulin at 'Lys-40' and hence controls neuronal motility, oligodendroglial cell arbor projection processes and proliferation of non-neuronal cells (PubMed : 18332217, PubMed : 18995842). Phosphorylation at Ser-368 by a G1/S-specific cyclin E-CDK2 complex inactivates SIRT2-mediated alpha-tubulin deacetylation, negatively regulating cell adhesion, cell migration and neurite outgrowth during neuronal differentiation (PubMed : 17488717). Deacetylates PARD3 and participates in the regulation of Schwann cell peripheral myelination formation during early postnatal development and during postinjury remyelination (PubMed : 21949390). Involved in several cellular metabolic pathways (PubMed : 20543840, PubMed : 21726808, PubMed : 24769394). Plays a role in the regulation of blood glucose homeostasis by deacetylating and stabilizing phosphoenolpyruvate carboxykinase PCK1 activity in response to low nutrient availability (PubMed : 21726808). Acts as a key regulator in the pentose phosphate pathway (PPP) by deacetylating and activating the glucose-6-phosphate G6PD enzyme, and therefore, stimulates the production of cytosolic NADPH to counteract oxidative damage (PubMed : 24769394). Maintains energy homeostasis in response to nutrient deprivation as well as energy expenditure by inhibiting adipogenesis and promoting lipolysis (PubMed : 20543840). Attenuates adipocyte differentiation by deacetylating and promoting FOXO1 interaction to PPARG and subsequent repression of PPARG-dependent transcriptional activity (PubMed : 20543840). Plays a role in the regulation of lysosome-mediated degradation of protein aggregates by autophagy in neuronal cells (PubMed : 20543840). Deacetylates FOXO1 in response to oxidative stress or serum deprivation, thereby negatively regulating FOXO1-mediated autophagy (PubMed : 20543840). Deacetylates a broad range of transcription factors and co-regulators regulating target gene expression. Deacetylates transcriptional factor FOXO3 stimulating the ubiquitin ligase SCF(SKP2)-mediated FOXO3 ubiquitination and degradation (By similarity). Deacetylates HIF1A and therefore promotes HIF1A degradation and inhibition of HIF1A transcriptional activity in tumor cells in response to hypoxia (PubMed : 24681946). Deacetylates RELA in the cytoplasm inhibiting NF-kappaB-dependent transcription activation upon TNF-alpha stimulation (PubMed : 21081649). Inhibits transcriptional activation by deacetylating p53/TP53 and EP300 (PubMed : 18249187, PubMed : 18995842). Deacetylates also EIF5A (PubMed : 22771473). Functions as a negative regulator on oxidative stress-tolerance in response to anoxia-reoxygenation conditions (PubMed : 24769394). Plays a role as tumor suppressor (PubMed : 22014574). In addition to protein deacetylase activity, also has activity toward long-chain fatty acyl groups and mediates protein-lysine demyristoylation and depalmitoylation of target proteins, such as ARF6 and KRAS, thereby regulating their association with membranes (PubMed : 25704306, PubMed : 29239724, PubMed : 32103017).. Isoform 1. Deacetylates EP300, alpha-tubulin and histone H3 and H4.. Isoform 2. Deacetylates EP300, alpha-tubulin and histone H3 and H4.. Isoform 5. Lacks deacetylation activity, at least toward known SIRT2 targets.
See full target information SIRT2

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com