JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB176062

Recombinant Human SIRT5 protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human SIRT5 protein (His tag N-Terminus) is a Human Full Length protein, in the 34 to 310 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

SIR2L5, SIRT5, Regulatory protein SIR2 homolog 5, SIR2-like protein 5

1 Images
SDS-PAGE - Recombinant Human SIRT5 protein (His tag N-Terminus) (AB176062)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human SIRT5 protein (His tag N-Terminus) (AB176062)

15% SDS-PAGE analysis of ab176062 (3μg).

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

Q9NXA8

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 30% Glycerol (glycerin, glycerine), 0.88% Sodium chloride, 0.32% Tris-HCl buffer, 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSARPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALACHENETVS","proteinLength":"Full Length","predictedMolecularWeight":"32.5 kDa","actualMolecularWeight":null,"aminoAcidEnd":310,"aminoAcidStart":34,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q9NXA8","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

SIRT5 also known as Sirtuin 5 is a mitochondrial protein with enzymatic activity as a lysine desuccinylase demalonylase and deglutarylase. It has a molecular mass of approximately 34 kDa. This protein is expressed highly in tissues with high metabolic activity like the liver heart and brain where it participates in regulating energy metabolism. The activity of SIRT5 affects cellular processes by removing post-translational modifications from lysine residues modulating proteins' functions and interactions in these tissues.
Biological function summary

SIRT5 functions as an important regulator of mitochondrial metabolism and influences cellular energy homeostasis. It is not part of larger complexes but it interacts with various metabolic enzymes to control their function. Through its deacylase activity SIRT5 affects the urea cycle and fatty acid oxidation by modifying key enzymes involved in these processes. Its role in maintaining a balance in energy production and consumption highlights its importance in cellular metabolism.

Pathways

SIRT5 is involved in both the tricarboxylic acid (TCA) cycle and the regulation of reactive oxygen species (ROS). Within the TCA cycle SIRT5 desuccinylates and activates enzymes like citrate synthase enhancing the cycle's efficiency. In regulating ROS SIRT5 reduces oxidative stress by affecting enzymes such as superoxide dismutase 2 (SOD2). Its interaction with these pathways and proteins reflects its role in maintaining metabolic health and cellular integrity.

Alterations in SIRT5 levels have been connected to metabolic diseases such as obesity and neurodegenerative disorders like Alzheimer's disease. In obesity SIRT5 dysregulation can lead to inefficient metabolic processes and energy imbalance. In Alzheimer’s decreased SIRT5 activity may contribute to increased mitochondrial oxidative stress implicated in disease progression. These connections highlight SIRT5’s significance in both metabolic and neurodegenerative contexts linking with proteins like AMPK in obesity and tau proteins in Alzheimer's disease.

Specifications

Form

Liquid

Additional notes

ab176062 is purified using conventional chromatography techniques.

General info

Function

NAD-dependent lysine demalonylase, desuccinylase and deglutarylase that specifically removes malonyl, succinyl and glutaryl groups on target proteins (PubMed : 21908771, PubMed : 22076378, PubMed : 24703693, PubMed : 29180469). Activates CPS1 and contributes to the regulation of blood ammonia levels during prolonged fasting : acts by mediating desuccinylation and deglutarylation of CPS1, thereby increasing CPS1 activity in response to elevated NAD levels during fasting (PubMed : 22076378, PubMed : 24703693). Activates SOD1 by mediating its desuccinylation, leading to reduced reactive oxygen species (PubMed : 24140062). Activates SHMT2 by mediating its desuccinylation (PubMed : 29180469). Modulates ketogenesis through the desuccinylation and activation of HMGCS2 (By similarity). Has weak NAD-dependent protein deacetylase activity; however this activity may not be physiologically relevant in vivo. Can deacetylate cytochrome c (CYCS) and a number of other proteins in vitro such as UOX.

Sequence similarities

Belongs to the sirtuin family. Class III subfamily.

Subcellular localisation

Mitochondrion matrix

Product protocols

Target data

NAD-dependent lysine demalonylase, desuccinylase and deglutarylase that specifically removes malonyl, succinyl and glutaryl groups on target proteins (PubMed : 21908771, PubMed : 22076378, PubMed : 24703693, PubMed : 29180469). Activates CPS1 and contributes to the regulation of blood ammonia levels during prolonged fasting : acts by mediating desuccinylation and deglutarylation of CPS1, thereby increasing CPS1 activity in response to elevated NAD levels during fasting (PubMed : 22076378, PubMed : 24703693). Activates SOD1 by mediating its desuccinylation, leading to reduced reactive oxygen species (PubMed : 24140062). Activates SHMT2 by mediating its desuccinylation (PubMed : 29180469). Modulates ketogenesis through the desuccinylation and activation of HMGCS2 (By similarity). Has weak NAD-dependent protein deacetylase activity; however this activity may not be physiologically relevant in vivo. Can deacetylate cytochrome c (CYCS) and a number of other proteins in vitro such as UOX.
See full target information SIRT5

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com