JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB114385

Recombinant Human SKP2 protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human SKP2 protein (GST tag N-Terminus) is a Human Full Length protein, in the 1 to 424 aa range, expressed in Wheat germ, with >80%, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

FBXL1, SKP2, S-phase kinase-associated protein 2, Cyclin-A/CDK2-associated protein p45, F-box protein Skp2, F-box/LRR-repeat protein 1, p45skp2

1 Images
SDS-PAGE - Recombinant Human SKP2 protein (GST tag N-Terminus) (AB114385)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human SKP2 protein (GST tag N-Terminus) (AB114385)

ab114385 analysed on a 12.5% SDS-PAGE Stained with Coomassie Blue.

Key facts

Purity

>80%

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, ELISA, SDS-PAGE

applications

Biologically active

No

Accession

Q13309

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.3% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPDSENIPQELLSNLGHPESPPRKRLKSKGSDKDFVIVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQKPSCL","proteinLength":"Full Length","predictedMolecularWeight":"72.71 kDa","actualMolecularWeight":null,"aminoAcidEnd":424,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q13309","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

S-phase kinase-associated protein 2 (SKP2) also known as FBL1 or p45 is an E3 ubiquitin ligase that tags proteins for degradation. It weighs around 48 kDa. SKP2 facilitates the transition from the G1 to S phase of the cell cycle by targeting cyclin-dependent kinase inhibitors for proteasomal destruction. Expressed in various tissues including key roles in proliferating cells SKP2 ensures the regulation of cell cycle progression and stability.
Biological function summary

SKP2 is part of the SCF (SKP1-CUL1-F-box) complex which is instrumental in controlling cell cycle and cell division. It regulates the degradation of p27^Kip1 and other cell cycle regulators. By modulating proteolysis SKP2 contributes to the maintenance of cell proliferation and it has essential roles in cellular responses to growth signals. Moreover SKP2 influences processes such as DNA replication through its effect on substrate interaction and ubiquitination.

Pathways

SKP2 functions inside the ubiquitin-proteasome system and impacts the PI3K/AKT signaling pathway. SKP2 advances cell cycle progression by associating with proteins like p27^Kip1 and CDK2 facilitating cell division. It modulates the phosphorylation state of numerous targets influencing signaling processes that control cell growth. This involvement aligns SKP2 with key cellular pathways that maintain cell survival and metabolic balance.

SKP2 plays an important role in cancer and cardiovascular diseases. In various cancers the aberrant expression of SKP2 connects to excessive cell proliferation and tumor growth partially through interactions with oncoproteins like Myc. In cardiovascular conditions SKP2 influences cardiac hypertrophy and might link to proteins such as cyclin-dependent kinase inhibitors. The regulation by SKP2 affects these proteins' stability impacting disease progression and potential therapeutic interventions.

Specifications

Form

Liquid

Additional notes

Glutathione Sepharose

General info

Function

Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins involved in cell cycle progression, signal transduction and transcription (PubMed : 11931757, PubMed : 12435635, PubMed : 12769844, PubMed : 12840033, PubMed : 15342634, PubMed : 15668399, PubMed : 15949444, PubMed : 16103164, PubMed : 16262255, PubMed : 16581786, PubMed : 16951159, PubMed : 17908926, PubMed : 17962192, PubMed : 22464731, PubMed : 22770219, PubMed : 32267835). Specifically recognizes phosphorylated CDKN1B/p27kip and is involved in regulation of G1/S transition (By similarity). Degradation of CDKN1B/p27kip also requires CKS1 (By similarity). Recognizes target proteins ORC1, CDT1, RBL2, KMT2A/MLL1, CDK9, RAG2, NBN, FOXO1, UBP43, YTHDF2, and probably MYC, TOB1 and TAL1 (PubMed : 11931757, PubMed : 12435635, PubMed : 12769844, PubMed : 12840033, PubMed : 15342634, PubMed : 15668399, PubMed : 15949444, PubMed : 16103164, PubMed : 16581786, PubMed : 16951159, PubMed : 17908926, PubMed : 17962192, PubMed : 22464731, PubMed : 32267835). Degradation of TAL1 also requires STUB1 (PubMed : 17962192). Recognizes CDKN1A in association with CCNE1 or CCNE2 and CDK2 (PubMed : 16262255). Promotes ubiquitination and destruction of CDH1 in a CK1-dependent manner, thereby regulating cell migration (PubMed : 22770219). Following phosphorylation in response to DNA damage, mediates 'Lys-63'-linked ubiquitination of NBN, promoting ATM recruitment to DNA damage sites and DNA repair via homologous recombination (PubMed : 22464731).. Through the ubiquitin-mediated proteasomal degradation of hepatitis C virus non-structural protein 5A, has an antiviral activity towards that virus.

Post-translational modifications

Phosphorylated on serine and threonine resudues in response to DNA damage, promoting 'Lys-63'-linked ubiquitination of NBN.. Ubiquitinated by the APC/C complex, leading to its degradation by the proteasome. Deubiquitinated by USP13.. Acetylation at Lys-68 and Lys-71 increases stability through impairment of APC/C-mediated proteolysis and promotes cytoplasmic retention. Deacetylated by SIRT3.

Subcellular localisation

Nucleus

Product protocols

Target data

Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins involved in cell cycle progression, signal transduction and transcription (PubMed : 11931757, PubMed : 12435635, PubMed : 12769844, PubMed : 12840033, PubMed : 15342634, PubMed : 15668399, PubMed : 15949444, PubMed : 16103164, PubMed : 16262255, PubMed : 16581786, PubMed : 16951159, PubMed : 17908926, PubMed : 17962192, PubMed : 22464731, PubMed : 22770219, PubMed : 32267835). Specifically recognizes phosphorylated CDKN1B/p27kip and is involved in regulation of G1/S transition (By similarity). Degradation of CDKN1B/p27kip also requires CKS1 (By similarity). Recognizes target proteins ORC1, CDT1, RBL2, KMT2A/MLL1, CDK9, RAG2, NBN, FOXO1, UBP43, YTHDF2, and probably MYC, TOB1 and TAL1 (PubMed : 11931757, PubMed : 12435635, PubMed : 12769844, PubMed : 12840033, PubMed : 15342634, PubMed : 15668399, PubMed : 15949444, PubMed : 16103164, PubMed : 16581786, PubMed : 16951159, PubMed : 17908926, PubMed : 17962192, PubMed : 22464731, PubMed : 32267835). Degradation of TAL1 also requires STUB1 (PubMed : 17962192). Recognizes CDKN1A in association with CCNE1 or CCNE2 and CDK2 (PubMed : 16262255). Promotes ubiquitination and destruction of CDH1 in a CK1-dependent manner, thereby regulating cell migration (PubMed : 22770219). Following phosphorylation in response to DNA damage, mediates 'Lys-63'-linked ubiquitination of NBN, promoting ATM recruitment to DNA damage sites and DNA repair via homologous recombination (PubMed : 22464731).. Through the ubiquitin-mediated proteasomal degradation of hepatitis C virus non-structural protein 5A, has an antiviral activity towards that virus.
See full target information SKP2

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com