JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB219428

Recombinant Human SLAMF6 protein (His tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human SLAMF6 protein (His tag) is a Human Fragment protein, in the 22 to 226 aa range, expressed in Baculovirus infected insect cells, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

CD352, KALI, UNQ6123/PRO20080, SLAMF6, SLAM family member 6, Activating NK receptor, NK-T-B-antigen, NTB-A

1 Images
SDS-PAGE - Recombinant Human SLAMF6 protein (His tag) (AB219428)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human SLAMF6 protein (His tag) (AB219428)

15% SDS-PAGE analysis of ab219428 (3μg).

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

Baculovirus infected insect cells

Tags

His tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Q96DU3

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: 90% PBS, 10% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

You may be interested in:

AB277424

Human SLAMF6 ELISA Kit

0

0 Reviews

View product

We recommend this product because it’s often used in the same experiment or related research.

We advise that you always check the datasheet to ensure it fits your experiments, or contact ourtechnical teamfor help.

Sequence info

[{"sequence":"ADPQSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTKMHHHHHH","proteinLength":"Fragment","predictedMolecularWeight":"24.1 kDa","actualMolecularWeight":null,"aminoAcidEnd":226,"aminoAcidStart":22,"nature":"Recombinant","expressionSystem":"Baculovirus infected insect cells","accessionNumber":"Q96DU3","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

SLAMF6 also known as CD352 is a protein that functions as a signaling lymphocytic activation molecule. It is a member of the SLAM family and is found on the surface of many immune cells including T cells B cells and natural killer (NK) cells. SLAMF6 has a molecular weight of approximately 71 kDa. This protein plays a role in cell-to-cell adhesion and transduction of activation signals. Its expression appears prominently in lymphoid tissues directing immune responses.
Biological function summary

SLAMF6 assists in modulating immune cell interactions and is part of specific receptor complexes. It influences the activation and proliferation of immune cells and contributes to the maintenance of immune homeostasis. SLAMF6 interacts with signaling pathways involving SAP (SLAM-associated protein) and EAT-2 which facilitate downstream signaling events essential for immune cell function and communication.

Pathways

SLAMF6 integrates within the SLAM receptor signaling pathway impacting the regulation of immune responses. It plays a role in the NF-kB signaling pathway important for inflammatory and immune responses. Related proteins in these pathways include SAP and EAT-2 important in signal transduction cascades that affect cell survival differentiation and function of immune cells.

SLAMF6 ties to autoimmune diseases and certain cancers. It is involved in autoimmune conditions such as systemic lupus erythematosus where malfunction in immune regulation occurs. Additionally deregulation of SLAMF6 expression associates with lymphomas impacting cell communication and immune function. In these conditions SLAMF6 interacts with SAP influencing the disease progression through altered immune signaling pathways.

Specifications

Form

Liquid

Additional notes

Affinity purified

General info

Function

Self-ligand receptor of the signaling lymphocytic activation molecule (SLAM) family. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and thus are involved in the regulation and interconnection of both innate and adaptive immune response. Activities are controlled by presence or absence of small cytoplasmic adapter proteins, SH2D1A/SAP and/or SH2D1B/EAT-2. Triggers cytolytic activity only in natural killer cells (NK) expressing high surface densities of natural cytotoxicity receptors (PubMed : 11489943, PubMed : 16920955). Positive signaling in NK cells implicates phosphorylation of VAV1. NK cell activation seems to depend on SH2D1B and not on SH2D1A (PubMed : 16920955). In conjunction with SLAMF1 controls the transition between positive selection and the subsequent expansion and differentiation of the thymocytic natural killer T (NKT) cell lineage (By similarity). Promotes T-cell differentiation into a helper T-cell Th17 phenotype leading to increased IL-17 secretion; the costimulatory activity requires SH2D1A (PubMed : 16920955, PubMed : 22184727). Promotes recruitment of RORC to the IL-17 promoter (PubMed : 22989874). In conjunction with SLAMF1 and CD84/SLAMF5 may be a negative regulator of the humoral immune response. In the absence of SH2D1A/SAP can transmit negative signals to CD4(+) T-cells and NKT cells. Negatively regulates germinal center formation by inhibiting T-cell : B-cell adhesion; the function probably implicates increased association with PTPN6/SHP-1 via ITSMs in absence of SH2D1A/SAP. However, reported to be involved in maintaining B-cell tolerance in germinal centers and in preventing autoimmunity (By similarity).

Post-translational modifications

Phosphorylation in NK cells upon engagment by SLAMF6-expressing target cells is leading to receptor activation.

Product protocols

For this product, it's our understanding that no specific protocols are required. You can visit:

Target data

Self-ligand receptor of the signaling lymphocytic activation molecule (SLAM) family. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and thus are involved in the regulation and interconnection of both innate and adaptive immune response. Activities are controlled by presence or absence of small cytoplasmic adapter proteins, SH2D1A/SAP and/or SH2D1B/EAT-2. Triggers cytolytic activity only in natural killer cells (NK) expressing high surface densities of natural cytotoxicity receptors (PubMed : 11489943, PubMed : 16920955). Positive signaling in NK cells implicates phosphorylation of VAV1. NK cell activation seems to depend on SH2D1B and not on SH2D1A (PubMed : 16920955). In conjunction with SLAMF1 controls the transition between positive selection and the subsequent expansion and differentiation of the thymocytic natural killer T (NKT) cell lineage (By similarity). Promotes T-cell differentiation into a helper T-cell Th17 phenotype leading to increased IL-17 secretion; the costimulatory activity requires SH2D1A (PubMed : 16920955, PubMed : 22184727). Promotes recruitment of RORC to the IL-17 promoter (PubMed : 22989874). In conjunction with SLAMF1 and CD84/SLAMF5 may be a negative regulator of the humoral immune response. In the absence of SH2D1A/SAP can transmit negative signals to CD4(+) T-cells and NKT cells. Negatively regulates germinal center formation by inhibiting T-cell : B-cell adhesion; the function probably implicates increased association with PTPN6/SHP-1 via ITSMs in absence of SH2D1A/SAP. However, reported to be involved in maintaining B-cell tolerance in germinal centers and in preventing autoimmunity (By similarity).
See full target information SLAMF6

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Associated Products

Select an associated product type
Alternative Product
Proteins & Peptides

AB151940

Recombinant Human SLAMF6 protein

proteins-peptides

recombinant-human-slamf6-protein-ab151940

0

(0 reviews)

Alternative Product
Proteins & Peptides

AB137148

Recombinant Human SLAMF6 protein (denatured)

proteins-peptides

recombinant-human-slamf6-protein-denatured-ab137148

0

(0 reviews)

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com