JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB151337

Recombinant Human SLAMF7/CS1 protein

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant Human SLAMF7/CS1 protein is a Human Fragment protein, in the 23 to 226 aa range, expressed in HEK 293 cells, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE, HPLC.

View Alternative Names

CD319, CS1, UNQ576/PRO1138, SLAMF7, SLAM family member 7, CD2 subset 1, CD2-like receptor-activating cytotoxic cells, Membrane protein FOAP-12, Novel Ly9, Protein 19A, CRACC

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

HEK 293 cells

Tags

His tag C-Terminus

Applications

SDS-PAGE, HPLC

applications

Biologically active

No

Accession

Q9NQ25

Animal free

No

Carrier free

No

Species

Human

Reconstitution

Reconstitute in PBS

Storage buffer

pH: 7.4 Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Aliquots of reconstituted samples are stable at <-20°C for 3 months.

This product was previously labelled as SLAMF7

This product was previously labelled as SLAMF7

Sequence info

[{"sequence":"SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSVDHHHHHH","proteinLength":"Fragment","predictedMolecularWeight":"23.2 kDa","actualMolecularWeight":null,"aminoAcidEnd":226,"aminoAcidStart":23,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q9NQ25","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
A few weeks
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

SLAMF7 also known as CS1 is a glycoprotein with a mass of approximately 70 kDa. This protein localizes on the surface of immune cells mainly on natural killer (NK) cells certain subsets of T cells and mature dendritic cells. It does not express in resting B cells but can be induced upon activation. CS1 plays a role in immune modulation by facilitating cell-to-cell interactions and activating various signaling pathways that enable immune responses.
Biological function summary

SLAMF7/CS1 modulates immune functions by engaging in interactions with other cell surface receptors. It often operates in the context of hematopoietic cells integrating signals that influence cell proliferation differentiation and survival. It does not require an associated adaptor molecule like most of the SLAM family members as it signals through its ability to recruit EAT-2. The CS1 protein modulates pathways related to immune cell activation and control making it an important player in the regulation of immune responses.

Pathways

CS1 participates prominently in immune signaling pathways where it interacts with proteins such as SAP and EAT-2. It is particularly involved in the immunoregulatory interactions contributing to NK cell-mediated cytotoxicity and modulation of T-cell responses. These interactions illustrate CS1's role in the modulation of immune responses positioning it within the broader network of immune signaling pathways important for maintaining immune homeostasis and defense mechanisms.

SLAMF7/CS1 shows key relevance in multiple myeloma and systemic lupus erythematosus (SLE). In multiple myeloma CS1 presents an overexpression and serves as a therapeutic target; its relationship with CD38 another important marker illustrates the potential for targeted therapies. In SLE improper signaling involving CS1 can contribute to the dysregulation of immune responses. Overall the intricate interactions of CS1 with other proteins highlight its significance in disease pathology and therapeutic potential.

Specifications

Form

Lyophilized

Additional notes

The purity of ab151337 is greater than 95%, as determined by SEC-HPLC and reducing SDS-PAGE.

General info

Function

Self-ligand receptor of the signaling lymphocytic activation molecule (SLAM) family. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and thus are involved in the regulation and interconnection of both innate and adaptive immune response. Activities are controlled by presence or absence of small cytoplasmic adapter proteins, SH2D1A/SAP and/or SH2D1B/EAT-2. Isoform 1 mediates NK cell activation through a SH2D1A-independent extracellular signal-regulated ERK-mediated pathway (PubMed : 11698418). Positively regulates NK cell functions by a mechanism dependent on phosphorylated SH2D1B. Downstream signaling implicates PLCG1, PLCG2 and PI3K (PubMed : 16339536). In addition to heterotypic NK cells-target cells interactions also homotypic interactions between NK cells may contribute to activation. However, in the absence of SH2D1B, inhibits NK cell function. Acts also inhibitory in T-cells (By similarity). May play a role in lymphocyte adhesion (PubMed : 11802771). In LPS-activated monocytes negatively regulates production of pro-inflammatory cytokines (PubMed : 23695528).. Isoform 3 does not mediate any NK cell activation.

Product protocols

Target data

Self-ligand receptor of the signaling lymphocytic activation molecule (SLAM) family. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and thus are involved in the regulation and interconnection of both innate and adaptive immune response. Activities are controlled by presence or absence of small cytoplasmic adapter proteins, SH2D1A/SAP and/or SH2D1B/EAT-2. Isoform 1 mediates NK cell activation through a SH2D1A-independent extracellular signal-regulated ERK-mediated pathway (PubMed : 11698418). Positively regulates NK cell functions by a mechanism dependent on phosphorylated SH2D1B. Downstream signaling implicates PLCG1, PLCG2 and PI3K (PubMed : 16339536). In addition to heterotypic NK cells-target cells interactions also homotypic interactions between NK cells may contribute to activation. However, in the absence of SH2D1B, inhibits NK cell function. Acts also inhibitory in T-cells (By similarity). May play a role in lymphocyte adhesion (PubMed : 11802771). In LPS-activated monocytes negatively regulates production of pro-inflammatory cytokines (PubMed : 23695528).. Isoform 3 does not mediate any NK cell activation.
See full target information SLAMF7

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

Oncotarget 9:34784-34793 PubMed30410677

2018

Clinical impact of serum soluble SLAMF7 in multiple myeloma.

Applications

Unspecified application

Species

Unspecified reactive species

Mariko Ishibashi,Saori Soeda,Makoto Sasaki,Hiroshi Handa,Yoichi Imai,Norina Tanaka,Sakae Tanosaki,Shigeki Ito,Takeshi Odajima,Hiroki Sugimori,Toshio Asayama,Mika Sunakawa,Yuta Kaito,Ryosuke Kinoshita,Yasuko Kuribayashi,Asaka Onodera,Keiichi Moriya,Junji Tanaka,Yutaka Tsukune,Norio Komatsu,Koiti Inokuchi,Hideto Tamura
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com