JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB171468

Recombinant Human SLC51B protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human SLC51B protein (His tag N-Terminus) is a Human Fragment protein, in the 57 to 128 aa range, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

OSTB, SLC51B, Organic solute transporter subunit beta, OST-beta, Solute carrier family 51 subunit beta

1 Images
SDS-PAGE - Recombinant Human SLC51B protein (His tag N-Terminus) (AB171468)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human SLC51B protein (His tag N-Terminus) (AB171468)

15% SDS-PAGE analysis of ab171468 (3μg).

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

Q86UW2

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 0.58% Sodium chloride, 0.32% Tris HCl

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

SLC51B, as known as OSTB, is an organic solute transporter subunit. SLC51 is composed of two distinct proteins that must heterodimerize to generate transport activity, but the role of the individual subunits in mediating transport activity is unknown. The results demonstrate that SLC51B is required for both proper trafficking of SLC51A and formation of the functional transport unit, and identify specific residues of SLC51B critical for these processes. Recombinant human SLC51B protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography.

This product was previously labelled as OST-beta

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSRSIQASRKEKMQPPEKETPEVLHLDEAKDHNSLNNLRETLLSEKPNLAQVELELKERDVLSVFLPDVPETES","proteinLength":"Fragment","predictedMolecularWeight":"10.7 kDa","actualMolecularWeight":null,"aminoAcidEnd":128,"aminoAcidStart":57,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q86UW2","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

SLC51B also known as OST-beta forms a heterodimer with SLC51A (OST-alpha) to function as an organic solute transporter involved in bile acid transport. This protein has a molecular mass of around 15 kDa. It is predominantly found in the ileum and liver key locations for bile acid circulation and metabolism. SLC51B localization to the basolateral membrane of enterocytes allows it to mediate transport across cellular barriers.
Biological function summary

SLC51B plays an important role in enterohepatic circulation by facilitating the transport of bile acids and steroids. It works as part of a transporter complex when combined with OST-alpha enhancing transport efficiency. This function helps in maintaining bile acid homeostasis and supports lipid digestion and absorption. SLC51B's activity assists in controlling cholesterol levels and prevents the accumulation of toxic bile acid concentrations within cells.

Pathways

The activity of SLC51B is integral to the enterohepatic bile acid recycling pathway and lipid metabolism pathways. It collaborates with proteins like NTCP and ASBT which are important for bile acid uptake in hepatocytes and enterocytes respectively. These pathways ensure efficient bile acid transport beginning from the liver its reabsorption in the intestines and return to the liver illustrating its central role in maintaining metabolic balance.

SLC51B plays a significant part in conditions like cholestasis and inflammatory bowel disease (IBD). Its role in bile acid transport links it to cholestasis where bile flow is reduced and its dysfunction can exacerbate the disease. Furthermore it associates with proteins such as FXR which regulates bile acid homeostasis and impacts inflammatory pathways contributing to the pathology of IBD. Understanding the relationship of SLC51B in these disorders highlights potential areas for therapeutic intervention.

Specifications

Form

Liquid

Additional notes

ab171468 is purified using conventional chromatography techniques.

General info

Function

Essential component of the Ost-alpha/Ost-beta complex, a heterodimer that acts as the intestinal basolateral transporter responsible for bile acid export from enterocytes into portal blood (PubMed : 16317684). Modulates SLC51A glycosylation, membrane trafficking and stability activities (PubMed : 16317684). The Ost-alpha/Ost-beta complex efficiently transports the major species of bile acids (taurocholate) (PubMed : 16317684). Taurine conjugates are transported more efficiently across the basolateral membrane than glycine-conjugated bile acids (By similarity). Can also transport steroids such as estrone 3-sulfate and dehydroepiandrosterone 3-sulfate, therefore playing a role in the enterohepatic circulation of sterols (PubMed : 16317684). Able to transport eicosanoids such as prostaglandin E2 (By similarity).

Sequence similarities

Belongs to the OST-beta family.

Product protocols

Target data

Essential component of the Ost-alpha/Ost-beta complex, a heterodimer that acts as the intestinal basolateral transporter responsible for bile acid export from enterocytes into portal blood (PubMed : 16317684). Modulates SLC51A glycosylation, membrane trafficking and stability activities (PubMed : 16317684). The Ost-alpha/Ost-beta complex efficiently transports the major species of bile acids (taurocholate) (PubMed : 16317684). Taurine conjugates are transported more efficiently across the basolateral membrane than glycine-conjugated bile acids (By similarity). Can also transport steroids such as estrone 3-sulfate and dehydroepiandrosterone 3-sulfate, therefore playing a role in the enterohepatic circulation of sterols (PubMed : 16317684). Able to transport eicosanoids such as prostaglandin E2 (By similarity).
See full target information SLC51B

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com