JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB99142

Recombinant Human SLPI protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human SLPI protein (His tag N-Terminus) is a Human Full Length protein, in the 26 to 132 aa range, expressed in Escherichia coli, with >80%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

WAP4, WFDC4, SLPI, Antileukoproteinase, ALP, BLPI, HUSI-1, Mucus proteinase inhibitor, Protease inhibitor WAP4, Secretory leukocyte protease inhibitor, Seminal proteinase inhibitor, WAP four-disulfide core domain protein 4, MPI

1 Images
SDS-PAGE - Recombinant Human SLPI protein (His tag N-Terminus) (AB99142)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human SLPI protein (His tag N-Terminus) (AB99142)

15% SDS-PAGE analysis of 3μg ab99142.

Key facts

Purity

>80% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

P03973

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.58% Sodium chloride, 0.316% Tris HCl, 0.0308% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMSGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVKA","proteinLength":"Full Length","predictedMolecularWeight":"14 kDa","actualMolecularWeight":null,"aminoAcidEnd":132,"aminoAcidStart":26,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P03973","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Secretory leukocyte protease inhibitor (SLPI) also known as antileukoproteinase and neutrophil elastase inhibitor is a protein with a molecular mass of approximately 12 kDa. SLPI is found mainly in epithelial tissues and is expressed in locations such as the respiratory tract skin and cervix. Mechanically SLPI functions as a serine protease inhibitor binding to and neutralizing enzymes like neutrophil elastase cathepsin G and trypsin which helps to limit tissue damage during inflammation.
Biological function summary

SLPI serves as a protector of epithelial surfaces from proteolytic degradation and acts as an anti-inflammatory agent. It displays broad-spectrum antimicrobial properties providing protection against bacterial and viral infections. Although SLPI is not part of a complex itself its interactions with extracellular matrix proteins help modulate wound healing processes and maintain tissue integrity.

Pathways

SLPI participates in the innate immune response and inflammation regulation pathways. It interacts within pathways that involve the complement cascade and kallikrein-kinin system helping to regulate inflammation and modulate immune responses. During these processes SLPI is related to proteins such as alpha-1-antitrypsin in its role as a protease inhibitor contributing to the regulation of protease activity and inflammatory responses.

SLPI is implicated in conditions such as chronic obstructive pulmonary disease (COPD) and cystic fibrosis where excessive protease activity leads to tissue damage. In these diseases SLPI shows a protective role against lung tissue degradation. SLPI is also associated with the progression of certain cancers like ovarian cancer where its overexpression may support tumor growth and metastasis. In these contexts SLPI relates to other protease inhibitors such as tissue inhibitors of metalloproteinases (TIMPs) due to their shared function in regulating protease activity and tissue remodeling.

Specifications

Form

Liquid

Additional notes

ab99142 was purified using conventional chromatography.

General info

Function

Acid-stable proteinase inhibitor with strong affinities for trypsin, chymotrypsin, elastase, and cathepsin G (PubMed : 10702419, PubMed : 2039600, PubMed : 2110563, PubMed : 24121345, PubMed : 3462719, PubMed : 3533531). Modulates the inflammatory and immune responses after bacterial infection, and after infection by the intracellular parasite L.major. Down-regulates responses to bacterial lipopolysaccharide (LPS) (By similarity). Plays a role in regulating the activation of NF-kappa-B and inflammatory responses (PubMed : 10702419, PubMed : 24352879). Has antimicrobial activity against mycobacteria, but not against salmonella. Contributes to normal resistance against infection by M.tuberculosis. Required for normal resistance to infection by L.major. Required for normal wound healing, probably by preventing tissue damage by limiting protease activity (By similarity). Together with ELANE, required for normal differentiation and proliferation of bone marrow myeloid cells (PubMed : 24352879).

Product protocols

Target data

Acid-stable proteinase inhibitor with strong affinities for trypsin, chymotrypsin, elastase, and cathepsin G (PubMed : 10702419, PubMed : 2039600, PubMed : 2110563, PubMed : 24121345, PubMed : 3462719, PubMed : 3533531). Modulates the inflammatory and immune responses after bacterial infection, and after infection by the intracellular parasite L.major. Down-regulates responses to bacterial lipopolysaccharide (LPS) (By similarity). Plays a role in regulating the activation of NF-kappa-B and inflammatory responses (PubMed : 10702419, PubMed : 24352879). Has antimicrobial activity against mycobacteria, but not against salmonella. Contributes to normal resistance against infection by M.tuberculosis. Required for normal resistance to infection by L.major. Required for normal wound healing, probably by preventing tissue damage by limiting protease activity (By similarity). Together with ELANE, required for normal differentiation and proliferation of bone marrow myeloid cells (PubMed : 24352879).
See full target information SLPI

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com