JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB201878

Recombinant Human SLUG protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human SLUG protein (His tag N-Terminus) is a Human Full Length protein, in the 1 to 268 aa range, expressed in Escherichia coli, with >80%, suitable for SDS-PAGE.

View Alternative Names

SLUG, SLUGH, SNAI2, Zinc finger protein SNAI2, Neural crest transcription factor Slug, Protein snail homolog 2

1 Images
SDS-PAGE - Recombinant Human SLUG protein (His tag N-Terminus) (AB201878)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human SLUG protein (His tag N-Terminus) (AB201878)

15% SDS Page analysis of ab201878 (3μg).

Key facts

Purity

>80% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

O43623

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 0.32% Tris HCl

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSMPRSFLVKKHFNASKKPNYSELDTHTVIISPYLYESYSMPVIPQPEILSSGAYSPITVWTTAAPFHAQLPNGLSPLSGYSSSLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYVSLGALKMHIRTHTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVKKYQCKNCSKTFSRMSLLHKHEESGCCVAH","proteinLength":"Full Length","predictedMolecularWeight":"32.4 kDa","actualMolecularWeight":null,"aminoAcidEnd":268,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"O43623","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

SLUG also known as SNAI2 is a zinc finger transcription factor that plays a mechanical role in the regulation of genes implicated in cell differentiation and development. With an approximate mass of 29 kDa SLUG is expressed in various tissues particularly in the neural crest and epithelial-cell precursors. It acts as a repressor by binding to E-box motifs in the promoter regions of its target genes. SLUG functions in coordination with other cofactors to modulate gene expression that influences diverse biological processes including epithelial-mesenchymal transition (EMT).
Biological function summary

SLUG influences cell motility and invasion by controlling EMT a process critical for development and cancer metastasis. SLUG functions as a part of the Snail family of transcription factors and collaborates with other EMT-related molecules. It influences the expression of genes that maintain the epithelial phenotype facilitating the switch to a mesenchymal state required for increased cell mobility. Through these actions SLUG participates in the dynamic remodeling of tissues and is an important player during embryonic development and in certain pathological conditions.

Pathways

Researchers have associated SLUG with the TGF-beta and Wnt signaling pathways both essential for cell growth and differentiation. These pathways support SLUG's role in promoting EMT by modulating its transcriptional activity. SLUG often interacts with proteins such as TWIST1 and ZEB1 which synergistically act to downregulate epithelial markers and upregulate mesenchymal markers. This synergy highlights SLUG's significant role in facilitating changes in cellular architecture and function.

SLUG shows a strong connection with the progression of cancers and fibrosis. It contributes to cancer metastasis through its competence in inducing EMT enabling tumor cells to invade and establish secondary tumors. In breast cancer SLUG correlates with increased invasiveness and poor prognosis. In fibrosis SLUG promotes tissue scarring by facilitating fibroblast activation and extracellular matrix deposition. SLUG has interactions with other proteins such as E-Cadherin where its repressing activity on E-Cadherin contributes to the disruption of cell-cell adhesion a hallmark of metastatic cells.

Specifications

Form

Liquid

General info

Function

Transcriptional repressor that modulates both activator-dependent and basal transcription. Involved in the generation and migration of neural crest cells. Plays a role in mediating RAF1-induced transcriptional repression of the TJ protein, occludin (OCLN) and subsequent oncogenic transformation of epithelial cells (By similarity). Represses BRCA2 expression by binding to its E2-box-containing silencer and recruiting CTBP1 and HDAC1 in breast cells. In epidermal keratinocytes, binds to the E-box in ITGA3 promoter and represses its transcription. Involved in the regulation of ITGB1 and ITGB4 expression and cell adhesion and proliferation in epidermal keratinocytes. Binds to E-box2 domain of BSG and activates its expression during TGFB1-induced epithelial-mesenchymal transition (EMT) in hepatocytes. Represses E-Cadherin/CDH1 transcription via E-box elements. Involved in osteoblast maturation. Binds to RUNX2 and SOC9 promoters and may act as a positive and negative transcription regulator, respectively, in osteoblasts. Binds to CXCL12 promoter via E-box regions in mesenchymal stem cells and osteoblasts. Plays an essential role in TWIST1-induced EMT and its ability to promote invasion and metastasis.

Sequence similarities

Belongs to the snail C2H2-type zinc-finger protein family.

Post-translational modifications

Phosphorylated by GSK3B. Once phosphorylated, it becomes a target for ubiquitination.. Ubiquitinated by the SCF(FBXO11) complex; ubiquitination requires previous GSK3B-mediated SNAI2 phosphorylation (PubMed:25827072).

Subcellular localisation

Nucleus

Product protocols

Target data

Transcriptional repressor that modulates both activator-dependent and basal transcription. Involved in the generation and migration of neural crest cells. Plays a role in mediating RAF1-induced transcriptional repression of the TJ protein, occludin (OCLN) and subsequent oncogenic transformation of epithelial cells (By similarity). Represses BRCA2 expression by binding to its E2-box-containing silencer and recruiting CTBP1 and HDAC1 in breast cells. In epidermal keratinocytes, binds to the E-box in ITGA3 promoter and represses its transcription. Involved in the regulation of ITGB1 and ITGB4 expression and cell adhesion and proliferation in epidermal keratinocytes. Binds to E-box2 domain of BSG and activates its expression during TGFB1-induced epithelial-mesenchymal transition (EMT) in hepatocytes. Represses E-Cadherin/CDH1 transcription via E-box elements. Involved in osteoblast maturation. Binds to RUNX2 and SOC9 promoters and may act as a positive and negative transcription regulator, respectively, in osteoblasts. Binds to CXCL12 promoter via E-box regions in mesenchymal stem cells and osteoblasts. Plays an essential role in TWIST1-induced EMT and its ability to promote invasion and metastasis.
See full target information SNAI2

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com