JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB104036

Recombinant Human Sm-E protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Sm-E protein (His tag N-Terminus) is a Human Full Length protein, in the 1 to 92 aa range, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

Small nuclear ribonucleoprotein E, snRNP-E, Sm protein E, Sm-E, SmE, SNRPE

1 Images
Western blot - Recombinant Human Sm-E protein (His tag N-Terminus) (AB104036)
  • WB

Unknown

Western blot - Recombinant Human Sm-E protein (His tag N-Terminus) (AB104036)

15% SDS-PAGE analysis of ab104036 (3 μg).

All lanes:

Western blot - Recombinant Human Sm-E protein (His tag N-Terminus) (ab104036)

false

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

P62304

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 30% Glycerol (glycerin, glycerine), 1.16% Sodium chloride, 0.316% Tris HCl, 0.077% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 0.0292% EDTA

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Previously labelled as SNRPE.

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN","proteinLength":"Full Length","predictedMolecularWeight":"12.9 kDa","actualMolecularWeight":null,"aminoAcidEnd":92,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P62304","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Sm-E also known as B/B' is a component of the spliceosomal small nuclear ribonucleoproteins (snRNPs) essential for pre-mRNA splicing. Sm-E has an approximate molecular weight of 9 kDa and shows expression in the nucleus. It plays a role both in the formation of the spliceosome and the catalysis of splicing reactions. Sm-E is a target for anti-Smith antibodies which are autoimmune antibodies found in patients with systemic lupus erythematosus (SLE).
Biological function summary

The function of Sm-E extends beyond the nucleus participating in the assembly of snRNPs along with several other Sm proteins to form a heptameric ring. This complex formation is vital for the stabilization and proper assembly of the spliceosome which removes introns from pre-mRNA. The presence of anti-Smith antibodies targeting Sm-E can affect the integrity of this spliceosome assembly.

Pathways

Research places Sm-E within key cellular processes like RNA splicing. The involvement of Sm-E in the spliceosome affects the maturation of mRNA which is important in the gene expression pathway. It works alongside other proteins such as Sm B and D in the U-snRNPs integral for canonical splicing events. Disruptions in this pathway due to aberrant functioning of Sm-E can have downstream effects on gene regulation.

Sm-E's interaction with anti-Smith antibodies links it to systemic lupus erythematosus an autoimmune disease characterized by the body attacking its own proteins. In SLE patients these antibodies target Sm proteins causing symptoms related to immune dysregulation. Although primarily associated with SLE researchers may also explore the involvement of such antibodies in other autoimmune conditions like mixed connective tissue disease where similar complexes and proteins like U1 snRNPs are implicated.

Specifications

Form

Liquid

Additional notes

Purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.

General info

Function

Plays a role in pre-mRNA splicing as a core component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome (PubMed : 11991638, PubMed : 18984161, PubMed : 19325628, PubMed : 23246290, PubMed : 23333303, PubMed : 25555158, PubMed : 26912367, PubMed : 28076346, PubMed : 28502770, PubMed : 28781166, PubMed : 32494006). Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes (PubMed : 11991638, PubMed : 28076346, PubMed : 28502770, PubMed : 28781166). As a component of the minor spliceosome, involved in the splicing of U12-type introns in pre-mRNAs (PubMed : 15146077). As part of the U7 snRNP it is involved in histone 3'-end processing (PubMed : 12975319).

Sequence similarities

Belongs to the snRNP Sm proteins family.

Subcellular localisation

Nucleus

Product protocols

Target data

Plays a role in pre-mRNA splicing as a core component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome (PubMed : 11991638, PubMed : 18984161, PubMed : 19325628, PubMed : 23246290, PubMed : 23333303, PubMed : 25555158, PubMed : 26912367, PubMed : 28076346, PubMed : 28502770, PubMed : 28781166, PubMed : 32494006). Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes (PubMed : 11991638, PubMed : 28076346, PubMed : 28502770, PubMed : 28781166). As a component of the minor spliceosome, involved in the splicing of U12-type introns in pre-mRNAs (PubMed : 15146077). As part of the U7 snRNP it is involved in histone 3'-end processing (PubMed : 12975319).
See full target information SNRPE

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com