JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB158843

Recombinant Human SMAD6 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human SMAD6 protein is a Human Fragment protein, in the 285 to 384 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

MADH6, SMAD6, Mothers against decapentaplegic homolog 6, MAD homolog 6, Mothers against DPP homolog 6, SMAD family member 6, SMAD 6, Smad6, hSMAD6

1 Images
SDS-PAGE - Recombinant Human SMAD6 protein (AB158843)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human SMAD6 protein (AB158843)

ab158843 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, ELISA

applications

Biologically active

No

Accession

O43541

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"RDEYKPLDLSDSTLSYTETEATNSLITAPGEFSDASMSPDATKPSHWCSVAYWEHRTRVGRLYAVYDQAVSIFYDLPQGSGFCLGQLNLEQRSESVRRTR","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":384,"aminoAcidStart":285,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"O43541","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

SMAD6 also known as MADH6 or SMAD family member 6 is an inhibitory regulator in the TGF-beta signaling pathway. It has a molecular mass of approximately 53 kDa. SMAD6 specifically binds to and inhibits the BMP (Bone Morphogenetic Protein) receptor-activated SMAD proteins mainly SMAD1 SMAD5 and SMAD8 preventing their phosphorylation and subsequent translocation into the nucleus. This protein is expressed in various tissues including the heart skeletal muscle and brain.
Biological function summary

SMAD6 plays a critical role in modulating BMP signaling. It functions not as part of a larger protein complex but as a direct antagonist to BMP-induced cellular responses. By binding to SMAD1 and SMAD5 SMAD6 impedes the transcriptional activity that promotes various cellular processes such as proliferation differentiation and apoptosis. This regulation is essential for maintaining cellular homeostasis and ensuring proper embryonic development.

Pathways

SMAD6 serves as an important checkpoint within the TGF-beta/BMP signaling pathway. It relates to other proteins such as SMAD7 which also functions as an inhibitory SMAD although SMAD6 is more selective in antagonizing BMP receptors. Through its actions SMAD6 aids in the regulation of processes like bone formation and vascular development. By throttling the BMP pathway SMAD6 maintains a balance between proliferative signals and inhibitory cues important for organogenesis.

Disrupted SMAD6 function associates with cardiovascular and skeletal abnormalities. Mutations or altered expression levels in SMAD6 have links to congenital heart defects where it fails to adequately regulate BMP signaling. This dysregulation can also involve proteins such as SMAD1 leading to improper cardiac development. Additionally SMAD6 might affect conditions like fibrodysplasia ossificans progressiva that feature abnormal bone growth further implicating the need for balanced BMP signaling in maintaining tissue integrity.

Specifications

Form

Liquid

General info

Function

Transforming growth factor-beta superfamily receptors signaling occurs through the Smad family of intracellular mediators. SMAD6 is an inhibitory Smad (i-Smad) that negatively regulates signaling downstream of type I transforming growth factor-beta (PubMed : 10647776, PubMed : 10708948, PubMed : 10708949, PubMed : 16951688, PubMed : 22275001, PubMed : 30848080, PubMed : 9436979, PubMed : 9759503). Acts as a mediator of TGF-beta and BMP anti-inflammatory activities. Suppresses IL1R-TLR signaling through its direct interaction with PEL1, preventing NF-kappa-B activation, nuclear transport and NF-kappa-B-mediated expression of pro-inflammatory genes (PubMed : 16951688). Blocks the BMP-SMAD1 signaling pathway by competing with SMAD4 for receptor-activated SMAD1-binding (PubMed : 30848080, PubMed : 9436979). Binds to regulatory elements in target promoter regions (PubMed : 16491121).

Sequence similarities

Belongs to the dwarfin/SMAD family.

Post-translational modifications

Phosphorylated by BMP type 1 receptor kinase and by PRKX.. Monoubiquitinated at Lys-173 by the E2/E3 hybrid ubiquitin-protein ligase UBE2O, leading to reduced binding affinity for the activated BMP type I receptor ACVR1/ALK2, thereby enhancing BMP7 and regulating adipocyte differentiation (PubMed:23455153). Ubiquitinated by WWP1 (By similarity). Ubiquitinated by ARK2C, promoting proteasomal degradation, leading to enhance the BMP-Smad signaling (By similarity).. Arginine methylation by PRMT1, which is recruited by BMPR2, initiates BMP-Induced signaling and induces dissociation from the BMPR1B receptor at the cell surface leading to derepress downstream Smad1/Smad5 signaling.

Subcellular localisation

Nucleus

Product protocols

Target data

Transforming growth factor-beta superfamily receptors signaling occurs through the Smad family of intracellular mediators. SMAD6 is an inhibitory Smad (i-Smad) that negatively regulates signaling downstream of type I transforming growth factor-beta (PubMed : 10647776, PubMed : 10708948, PubMed : 10708949, PubMed : 16951688, PubMed : 22275001, PubMed : 30848080, PubMed : 9436979, PubMed : 9759503). Acts as a mediator of TGF-beta and BMP anti-inflammatory activities. Suppresses IL1R-TLR signaling through its direct interaction with PEL1, preventing NF-kappa-B activation, nuclear transport and NF-kappa-B-mediated expression of pro-inflammatory genes (PubMed : 16951688). Blocks the BMP-SMAD1 signaling pathway by competing with SMAD4 for receptor-activated SMAD1-binding (PubMed : 30848080, PubMed : 9436979). Binds to regulatory elements in target promoter regions (PubMed : 16491121).
See full target information SMAD6

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com