JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB161516

Recombinant Human Smg1 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Smg1 protein is a Human Fragment protein, in the 2922 to 3031 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

ATX, KIAA0421, LIP, SMG1, Serine/threonine-protein kinase SMG1, SMG-1, hSMG-1, Lambda/iota protein kinase C-interacting protein, Nonsense mediated mRNA decay-associated PI3K-related kinase SMG1, Lambda-interacting protein

1 Images
SDS-PAGE - Recombinant Human Smg1 protein (AB161516)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Smg1 protein (AB161516)

ab161516 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, ELISA

applications

Biologically active

No

Accession

Q96Q15

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"PDVMSQNARKLIQKNLATSADTPPSTVPGTGKSVACSPKKAVRDPKTGKAVQERNSYAVSVWKRVKAKLEGRDVDPNRRMSVAEQVDYVIKEATNLDNLAQLYEGWTAWV","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":3031,"aminoAcidStart":2922,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q96Q15","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Smg1 also known as SMG-1 is a large protein kinase with a molecular mass of approximately 410 kDa. It localizes mainly in the cytoplasm and nucleus of cells and has an important mechanical role in phosphorylating proteins to regulate various cellular processes. As a part of the phosphatidylinositol 3-kinase-related kinase (PIKK) family Smg1 exhibits enzymatic activity that is important for maintaining cellular functions.
Biological function summary

Smg1 plays an important part in the nonsense-mediated mRNA decay (NMD) pathway an important cellular process for RNA surveillance mechanisms. Smg1 associates with other proteins forming a complex known as the SMG1C complex which monitors and degrades faulty mRNAs that contain premature stop codons to prevent the production of truncated proteins. Smg1 aids in safeguarding the cellular transcriptome integrity by ensuring quality control at the mRNA level.

Pathways

Smg1 interacts importantly within the NMD pathway alongside proteins UPF1 and UPF2 which are essential for proper function. Smg1 is also involved in the cellular response to stress pathways contributing to the regulation of stress granules. Through these pathways Smg1 ensures proper adaptation and response to changing cellular conditions maintaining overall cell health and functionality.

Smg1 has implications in cancer and genetic disorders. Aberrations in Smg1 activity or expression can lead to improper mRNA decay contributing to tumorigenesis by allowing defective mRNAs to produce malfunctioning proteins. In cancer Smg1 regulates p53 a protein that is associated with cell cycle control and apoptosis. Additionally mutations affecting Smg1 can relate to neurodevelopmental disorders where it influences proteins involved in mRNA processing pathways highlighting its role in nervous system function and development.

Specifications

Form

Liquid

General info

Function

Serine/threonine protein kinase involved in both mRNA surveillance and genotoxic stress response pathways. Recognizes the substrate consensus sequence [ST]-Q. Plays a central role in nonsense-mediated decay (NMD) of mRNAs containing premature stop codons by phosphorylating UPF1/RENT1. Recruited by release factors to stalled ribosomes together with SMG8 and SMG9 (forming the SMG1C protein kinase complex), and UPF1 to form the transient SURF (SMG1-UPF1-eRF1-eRF3) complex. In EJC-dependent NMD, the SURF complex associates with the exon junction complex (EJC) through UPF2 and allows the formation of an UPF1-UPF2-UPF3 surveillance complex which is believed to activate NMD. Also acts as a genotoxic stress-activated protein kinase that displays some functional overlap with ATM. Can phosphorylate p53/TP53 and is required for optimal p53/TP53 activation after cellular exposure to genotoxic stress. Its depletion leads to spontaneous DNA damage and increased sensitivity to ionizing radiation (IR). May activate PRKCI but not PRKCZ.

Sequence similarities

Belongs to the PI3/PI4-kinase family.

Post-translational modifications

Autophosphorylated.

Subcellular localisation

Nucleus

Product protocols

Target data

Serine/threonine protein kinase involved in both mRNA surveillance and genotoxic stress response pathways. Recognizes the substrate consensus sequence [ST]-Q. Plays a central role in nonsense-mediated decay (NMD) of mRNAs containing premature stop codons by phosphorylating UPF1/RENT1. Recruited by release factors to stalled ribosomes together with SMG8 and SMG9 (forming the SMG1C protein kinase complex), and UPF1 to form the transient SURF (SMG1-UPF1-eRF1-eRF3) complex. In EJC-dependent NMD, the SURF complex associates with the exon junction complex (EJC) through UPF2 and allows the formation of an UPF1-UPF2-UPF3 surveillance complex which is believed to activate NMD. Also acts as a genotoxic stress-activated protein kinase that displays some functional overlap with ATM. Can phosphorylate p53/TP53 and is required for optimal p53/TP53 activation after cellular exposure to genotoxic stress. Its depletion leads to spontaneous DNA damage and increased sensitivity to ionizing radiation (IR). May activate PRKCI but not PRKCZ.
See full target information SMG1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com