JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB114802

Recombinant Human SMN/Gemin 1 protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human SMN/Gemin 1 protein (GST tag N-Terminus) is a Human Full Length protein, in the 1 to 282 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

SMN, SMNT, SMN2, SMNC, SMN1, Survival motor neuron protein, Component of gems 1, Gemin-1

1 Images
SDS-PAGE - Recombinant Human SMN/Gemin 1 protein (GST tag N-Terminus) (AB114802)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human SMN/Gemin 1 protein (GST tag N-Terminus) (AB114802)

12.5% SDS-PAGE Stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, SDS-PAGE, ELISA

applications

Biologically active

No

Accession

Q16637

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.3% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>(Recombinant protein).</p>" } } }

Sequence info

[{"sequence":"MAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPPPPMPGPRLGPGKPGLKFNGPPPPPPPPPPHLLSCWLPPFPSGPPIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMEMLA","proteinLength":"Full Length","predictedMolecularWeight":"56.76 kDa","actualMolecularWeight":null,"aminoAcidEnd":282,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q16637","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

SMN also known as Survival of Motor Neuron protein or Gemin 1 is an important protein involved in the assembly of small nuclear ribonucleoproteins (snRNPs). It has a molecular mass of approximately 38 kDa. SMN proteins are expressed in almost all tissues with highest levels in spinal cord and brain tissues. They play a mechanical role in Gemin complex assisting RNA processing tasks which are essential in RNA metabolism alongside other Gemin proteins.
Biological function summary

The SMN protein operates within the SMN-Gemin complex a multi-protein assembly important for snRNP biogenesis and pre-mRNA splicing. This complex coordinates the maturation and transport of snRNPs facilitating the processing of precursor mRNAs in the nucleus. SMN and associated Gemin proteins mediate the assembly of Sm proteins onto snRNA ensuring accurate splicing mechanisms necessary for gene expression.

Pathways

The SMN protein is notably involved in the chaperone-assisted assembly pathway related to snRNP biogenesis. It plays a central role in the spliceosome assembly process working closely with Sm proteins and other RNA-binding proteins. Importantly SMN interacts with the ribonucleoprotein complex influencing mRNA splicing which integrates into the broader cell signaling pathways such as the cholinergic agonist pathways and RNA splicing pathways that regulate neuromuscular communication.

The deficiency or malfunction of SMN protein directly relates to Spinal Muscular Atrophy (SMA) an autosomal recessive disorder. SMA is characterized by motor neuron degeneration which can be attributed to insufficient SMN protein levels leading to compromised snRNP assembly and splicing. The SMN1 gene deletion or mutation reduces the available SMN protein linking this defect with the severity of SMA. Studies suggest that altering the expression levels of the related SMN2 gene can potentially modulate disease outcomes further emphasizing the connection between SMN protein and SMA pathogenesis.

Specifications

Form

Liquid

General info

Function

The SMN complex catalyzes the assembly of small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome, and thereby plays an important role in the splicing of cellular pre-mRNAs (PubMed : 18984161, PubMed : 9845364). Most spliceosomal snRNPs contain a common set of Sm proteins SNRPB, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF and SNRPG that assemble in a heptameric protein ring on the Sm site of the small nuclear RNA to form the core snRNP (Sm core) (PubMed : 18984161). In the cytosol, the Sm proteins SNRPD1, SNRPD2, SNRPE, SNRPF and SNRPG are trapped in an inactive 6S pICln-Sm complex by the chaperone CLNS1A that controls the assembly of the core snRNP (PubMed : 18984161). To assemble core snRNPs, the SMN complex accepts the trapped 5Sm proteins from CLNS1A forming an intermediate (PubMed : 18984161). Within the SMN complex, SMN1 acts as a structural backbone and together with GEMIN2 it gathers the Sm complex subunits (PubMed : 17178713, PubMed : 21816274, PubMed : 22101937). Binding of snRNA inside 5Sm ultimately triggers eviction of the SMN complex, thereby allowing binding of SNRPD3 and SNRPB to complete assembly of the core snRNP (PubMed : 31799625). Ensures the correct splicing of U12 intron-containing genes that may be important for normal motor and proprioceptive neurons development (PubMed : 23063131). Also required for resolving RNA-DNA hybrids created by RNA polymerase II, that form R-loop in transcription terminal regions, an important step in proper transcription termination (PubMed : 26700805). May also play a role in the metabolism of small nucleolar ribonucleoprotein (snoRNPs).

Sequence similarities

Belongs to the SMN family.

Subcellular localisation

Nucleus

Product protocols

Target data

The SMN complex catalyzes the assembly of small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome, and thereby plays an important role in the splicing of cellular pre-mRNAs (PubMed : 18984161, PubMed : 9845364). Most spliceosomal snRNPs contain a common set of Sm proteins SNRPB, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF and SNRPG that assemble in a heptameric protein ring on the Sm site of the small nuclear RNA to form the core snRNP (Sm core) (PubMed : 18984161). In the cytosol, the Sm proteins SNRPD1, SNRPD2, SNRPE, SNRPF and SNRPG are trapped in an inactive 6S pICln-Sm complex by the chaperone CLNS1A that controls the assembly of the core snRNP (PubMed : 18984161). To assemble core snRNPs, the SMN complex accepts the trapped 5Sm proteins from CLNS1A forming an intermediate (PubMed : 18984161). Within the SMN complex, SMN1 acts as a structural backbone and together with GEMIN2 it gathers the Sm complex subunits (PubMed : 17178713, PubMed : 21816274, PubMed : 22101937). Binding of snRNA inside 5Sm ultimately triggers eviction of the SMN complex, thereby allowing binding of SNRPD3 and SNRPB to complete assembly of the core snRNP (PubMed : 31799625). Ensures the correct splicing of U12 intron-containing genes that may be important for normal motor and proprioceptive neurons development (PubMed : 23063131). Also required for resolving RNA-DNA hybrids created by RNA polymerase II, that form R-loop in transcription terminal regions, an important step in proper transcription termination (PubMed : 26700805). May also play a role in the metabolism of small nucleolar ribonucleoprotein (snoRNPs).
See full target information SMN1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com