JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB113120

Recombinant Human SNRPD3/Sm-D3 protein

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant Human SNRPD3/Sm-D3 protein is a Human Full Length protein, in the 1 to 126 aa range, expressed in Escherichia coli, with >85%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

Small nuclear ribonucleoprotein Sm D3, Sm-D3, snRNP core protein D3, SNRPD3

1 Images
SDS-PAGE - Recombinant Human SNRPD3/Sm-D3 protein (AB113120)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human SNRPD3/Sm-D3 protein (AB113120)

15% SDS-PAGE analysis of ab113120 (3μg)

Key facts

Purity

>85% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

P62318

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 40% Glycerol (glycerin, glycerine), 2.92% Sodium chloride, 0.32% Tris HCl, 0.03% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 0.002% PMSF

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Previously labelled as SNRPD3.

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNIFQKRR","proteinLength":"Full Length","predictedMolecularWeight":"16 kDa","actualMolecularWeight":null,"aminoAcidEnd":126,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P62318","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

SNRPD3 also known as Sm-D3 is a protein that plays an important role in the assembly of small nuclear ribonucleoproteins (snRNPs) essential for pre-mRNA splicing. This protein has a molecular mass of approximately 10 kDa. It functions as a core component of the spliceosomal machinery an essential complex in eukaryotic gene expression. You can find SNRPD3 expressed in various tissues where pre-mRNA splicing activity is required reflecting its fundamental role in cellular processes.
Biological function summary

SNRPD3 participates in snRNP assembly by interacting with other Sm proteins to form a heptameric ring structure around small nuclear RNAs (snRNAs). As part of the major spliceosomal snRNPs SNRPD3 contributes to the modification and catalysis of pre-mRNA splicing. The protein also gets involved in RNA stability and regulation. As a member of the spliceosome complex SNRPD3 helps ensure the fidelity and precision of splicing events important for generating mature mRNA molecules.

Pathways

The actions of SNRPD3 lie within the splicing pathway and have implications in the gene expression pathway. Interaction occurs with other proteins such as SNRPD1 and SNRPD2 which are also part of the snRNP complex facilitating effective spliceosomal function. The U1 snRNP specifically involving SNRPD3 plays a part in the recognition of splice sites initiating the splicing of pre-mRNAs.

Issues with SNRPD3 function or expression might relate to autoimmune diseases such as lupus and some neurodegenerative conditions. Antinuclear antibodies targeting snRNP components including SNRPD3 are common in systemic lupus erythematosus indicating its involvement in the disease's pathology. Furthermore alterations in splicing mechanisms involving SNRPD3 might influence neurodegenerative disorders due to its role in RNA processing and stability potentially relating to other RNA-binding proteins like hnRNPs.

Specifications

Form

Liquid

Additional notes

ab113120 was purified using conventional chromatography.

General info

Function

Plays a role in pre-mRNA splicing as a core component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome (PubMed : 11991638, PubMed : 18984161, PubMed : 19325628, PubMed : 25555158, PubMed : 26912367, PubMed : 28076346, PubMed : 28502770, PubMed : 28781166, PubMed : 32494006). Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes (PubMed : 11991638, PubMed : 28076346, PubMed : 28502770, PubMed : 28781166). As a component of the minor spliceosome, involved in the splicing of U12-type introns in pre-mRNAs (PubMed : 15146077, PubMed : 33509932). As part of the U7 snRNP it is involved in histone pre-mRNA 3'-end processing (By similarity).

Sequence similarities

Belongs to the snRNP core protein family.

Post-translational modifications

Methylated on arginine residues by PRMT5 and PRMT7; probable asymmetric dimethylation which is required for assembly and biogenesis of snRNPs.

Subcellular localisation

Nucleus

Product protocols

Target data

Plays a role in pre-mRNA splicing as a core component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome (PubMed : 11991638, PubMed : 18984161, PubMed : 19325628, PubMed : 25555158, PubMed : 26912367, PubMed : 28076346, PubMed : 28502770, PubMed : 28781166, PubMed : 32494006). Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes (PubMed : 11991638, PubMed : 28076346, PubMed : 28502770, PubMed : 28781166). As a component of the minor spliceosome, involved in the splicing of U12-type introns in pre-mRNAs (PubMed : 15146077, PubMed : 33509932). As part of the U7 snRNP it is involved in histone pre-mRNA 3'-end processing (By similarity).
See full target information SNRPD3

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

Cell reports 30:1935-1950.e8 PubMed32049022

2020

Symmetric Arginine Dimethylation Is Selectively Required for mRNA Splicing and the Initiation of Type I and Type III Interferon Signaling.

Applications

Unspecified application

Species

Unspecified reactive species

Patrick J Metz,Keith A Ching,Tao Xie,Paulina Delgado Cuenca,Sherry Niessen,John H Tatlock,Kristen Jensen-Pergakes,Brion W Murray
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com