JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB640

Recombinant human Soluble TNF Receptor II protein

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant human Soluble TNF Receptor II protein is a Human Fragment protein, expressed in Escherichia coli, with >98%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS.

View Alternative Names

CD120b, TNFBR, TNFR2, TNFRSF1B, Tumor necrosis factor receptor superfamily member 1B, Tumor necrosis factor receptor 2, Tumor necrosis factor receptor type II, p75, p80 TNF-alpha receptor, TNF-R2, TNF-RII, TNFR-II

Key facts

Purity

>98% SDS-PAGE

Sterile filtered. Greater than 98% pure by SDS-PAGE and HPLC analyses.

Endotoxin level

< 1 EU/µg

Expression system

Escherichia coli

Tags

Tag free

Applications

SDS-PAGE, FuncS

applications

Biologically active

Yes

Biological activity

Determined by its inhibitory effect of the TNF-α mediated cytotoxicity in murine L-929 cells. The ED50 for this effect in the presence of 0.25 ng/ml of Recombinant Human TNF-α, is 0.125 μg/mL.

Accession

Animal free

No

Carrier free

No

Species

Human

Reconstitution

Reconstitute by adding 200ul dH2O

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"linker":null,"sequence":"MAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSP","proteinLength":"Fragment","predictedMolecularWeight":"18.9 kDa","actualMolecularWeight":null,"aminoAcidEnd":0,"aminoAcidStart":0,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P20333","tags":[]}]

Properties and storage information

Form
Lyophilized
Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Soluble TNF Receptor II also known as TNFRSF1B or CD120b acts as a decoy receptor that binds with tumor necrosis factor-alpha (TNF-α) in the serum and extracellular space. It has a molecular mass of approximately 75 kDa. This receptor is expressed in various tissues including the immune cells and plays a role in regulating inflammatory responses. By binding TNF-α Soluble TNF Receptor II prevents TNF-α from interacting with cell surface receptors modulating its inflammatory effects.
Biological function summary

Soluble TNF Receptor II modulates inflammation and immune response. It is a part of the TNF receptor superfamily and can take part in forming a receptor-ligand complex with TNF-α impacting the downstream signaling. This receptor acts to neutralize TNF-α activity by preventing its engagement with pro-inflammatory receptors on cell surfaces. Apart from its inhibitory role it also assists in the clearance of TNF-α from the circulation managing excess TNF-α levels in the body.

Pathways

Soluble TNF Receptor II is dominant in the TNF signaling pathway and the NF-κB pathway. These pathways manage immune response cell survival and apoptosis. TNFR1 another receptor in the TNF family plays a related role in the TNF signaling pathway and often collaborates with Soluble TNF Receptor II to regulate balance between cell death and cell survival. The complex formed by Soluble TNF Receptor II and TNF-α diminishes excessive inflammation by reducing active TNF-α available for binding with TNFR1.

Soluble TNF Receptor II holds significance in rheumatoid arthritis and inflammatory bowel disease. Its presence modifies the course of these diseases by modulating the levels and effects of TNF-α. The inhibition of TNF-α-driven inflammation through interaction with Soluble TNF Receptor II can reduce tissue damage and improve symptoms. In these contexts it shows links with TNF-α which is a well-known mediator of inflammation and plays a role in the pathophysiology of these inflammatory disorders.

General info

Function

Receptor with high affinity for TNFSF2/TNF and approximately 5-fold lower affinity for homotrimeric TNFSF1/lymphotoxin-alpha. The TRAF1/TRAF2 complex recruits the apoptotic suppressors BIRC2 and BIRC3 to TNFRSF1B/TNFR2. This receptor mediates most of the metabolic effects of TNF. Isoform 2 blocks TNF-induced apoptosis, which suggests that it regulates TNF function by antagonizing its biological activity.

Post-translational modifications

Phosphorylated; mainly on serine residues and with a very low level on threonine residues.. A soluble form (tumor necrosis factor binding protein 2) is produced from the membrane form by proteolytic processing.

Product protocols

Target data

Receptor with high affinity for TNFSF2/TNF and approximately 5-fold lower affinity for homotrimeric TNFSF1/lymphotoxin-alpha. The TRAF1/TRAF2 complex recruits the apoptotic suppressors BIRC2 and BIRC3 to TNFRSF1B/TNFR2. This receptor mediates most of the metabolic effects of TNF. Isoform 2 blocks TNF-induced apoptosis, which suggests that it regulates TNF function by antagonizing its biological activity.
See full target information TNFRSF1B

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

Proceedings of the National Academy of Sciences of the United States of America 113:12304-12309 PubMed27791020

2016

Essential protective role of tumor necrosis factor receptor 2 in neurodegeneration.

Applications

Unspecified application

Species

Unspecified reactive species

Yun Dong,Roman Fischer,Petrus J W Naudé,Olaf Maier,Csaba Nyakas,Maëlle Duffey,Eddy A Van der Zee,Doortje Dekens,Wanda Douwenga,Andreas Herrmann,Eric Guenzi,Roland E Kontermann,Klaus Pfizenmaier,Ulrich L M Eisel
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com