JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB159587

Recombinant Human Somatostatin protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Somatostatin protein (GST tag N-Terminus) is a Human Fragment protein, in the 26 to 116 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

Somatostatin, Growth hormone release-inhibiting factor, SST

1 Images
SDS-PAGE - Recombinant Human Somatostatin protein (GST tag N-Terminus) (AB159587)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Somatostatin protein (GST tag N-Terminus) (AB159587)

ab159587 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, WB

applications

Biologically active

No

Accession

P61278

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"PSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEPNQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC","proteinLength":"Fragment","predictedMolecularWeight":"35.75 kDa","actualMolecularWeight":null,"aminoAcidEnd":116,"aminoAcidStart":26,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P61278","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Somatostatin also known as growth hormone-inhibiting hormone (GHIH) is a peptide hormone with a molecular mass around 3200 Daltons. This protein is expressed mainly in the central nervous system including the hypothalamus as well as in the pancreas and gastrointestinal tract. Somatostatin consists of two biologically active forms: one with 14 amino acids and another with 28 amino acids. This target exerts its mechanical function by binding to specific G-protein-coupled somatostatin receptors leading to inhibition of various signaling pathways.
Biological function summary

Somatostatin regulates the endocrine system and affects neurotransmission and cell proliferation. It inhibits the secretion of several hormones such as growth hormone thyroid-stimulating hormone and insulin. Somatostatin also plays a role in reducing gastric acid secretion and slowing down gastrointestinal motility. While somatostatin does not act as part of a larger complex its action is highly localized in the tissues where it is produced and released.

Pathways

Somatostatin acts significantly in both the growth hormone and insulin signaling pathways. In the growth hormone pathway it serves as a counter-regulatory hormone to growth hormone-releasing hormone (GHRH) therefore controlling growth hormone levels. In the insulin signaling pathway somatostatin interacts with insulin and glucagon modulating glucose metabolism. It is also related to other proteins like cortistatin which shares similar functions and can bind to the same receptors.

Somatostatin is linked with conditions such as acromegaly and diabetes. In acromegaly excessive growth hormone production occurs due to reduced somatostatin activity making somatostatin analogs a therapeutic option. Meanwhile in diabetes altered somatostatin levels can influence insulin and glucagon balance affecting glucose homeostasis. Somatostatin’s interaction with its receptors and proteins like insulin plays an important role in the management of these conditions.

Specifications

Form

Liquid

General info

Function

Somatostatin-14. Inhibits the secretion of pituitary hormones, including that of growth hormone/somatotropin (GH1), PRL, ACTH, luteinizing hormone (LH) and TSH. Also impairs ghrelin- and GnRH-stimulated secretion of GH1 and LH; the inhibition of ghrelin-stimulated secretion of GH1 can be further increased by neuronostatin.. Neuronostatin. May enhance low-glucose-induced glucagon release by pancreatic alpha cells (By similarity). This effect may be mediated by binding to GPR107 and PKA activation (By similarity). May regulate cardiac contractile function (By similarity). May compromise cardiomyocyte viability (By similarity). In the central nervous system, may impair memory retention and may affect hippocampal excitability (By similarity). May also have anxiolytic and anorexigenic effects (By similarity). May play a role in arterial pressure regulation (By similarity). May inhibit basal, but not ghrelin- or GnRH-stimulated secretion of GH1 or LH, but does not affect the release of other pituitary hormones, including PRL, ACTH, FSH or TSH. Potentiates inhibitory action of somatostatin on ghrelin-stimulated secretion of GH1, but not that on GnRH-stimulated secretion of LH (PubMed : 29615476).

Sequence similarities

Belongs to the somatostatin family.

Post-translational modifications

C-terminal amidation of the neuronostatin peptide is required for its biological activity, including for the regulation of mean arterial pressure.

Product protocols

Target data

Somatostatin-14. Inhibits the secretion of pituitary hormones, including that of growth hormone/somatotropin (GH1), PRL, ACTH, luteinizing hormone (LH) and TSH. Also impairs ghrelin- and GnRH-stimulated secretion of GH1 and LH; the inhibition of ghrelin-stimulated secretion of GH1 can be further increased by neuronostatin.. Neuronostatin. May enhance low-glucose-induced glucagon release by pancreatic alpha cells (By similarity). This effect may be mediated by binding to GPR107 and PKA activation (By similarity). May regulate cardiac contractile function (By similarity). May compromise cardiomyocyte viability (By similarity). In the central nervous system, may impair memory retention and may affect hippocampal excitability (By similarity). May also have anxiolytic and anorexigenic effects (By similarity). May play a role in arterial pressure regulation (By similarity). May inhibit basal, but not ghrelin- or GnRH-stimulated secretion of GH1 or LH, but does not affect the release of other pituitary hormones, including PRL, ACTH, FSH or TSH. Potentiates inhibitory action of somatostatin on ghrelin-stimulated secretion of GH1, but not that on GnRH-stimulated secretion of LH (PubMed : 29615476).
See full target information Somatostatin

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com